You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
HSPD1
60 kDa heat shock protein, mitochondrial

Protein Summary
Description
Chaperonin implicated in mitochondrial protein import and macromolecular assembly. Together with Hsp10, facilitates the correct folding of imported proteins. May also prevent misfolding and promote the refolding and proper assembly of unfolded polypeptides generated under stress conditions in the mitochondrial matrix (PubMed:1346131, PubMed:11422376). The functional units of these chaperonins consist of heptameric rings of the large subunit Hsp60, which function as a back-to-back double ring. In a cyclic reaction, Hsp60 ring complexes bind one unfolded substrate protein per ring, followed by the binding of ATP and association with 2 heptameric rings of the co-chaperonin Hsp10. This leads to sequestration of the substrate protein in the inner cavity of Hsp60 where, for a certain period of time, it can fold undisturbed by other cell components. Synchronous hydrolysis of ATP in all Hsp60 subunits results in the dissociation of the chaperonin rings and the release of ADP and the folded sub ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000345042
  • ENSP00000340019
  • ENSG00000144381
  • ENST00000388968
  • ENSP00000373620

Symbol
  • HSP60
  • HLD4
  • CPN60
  • GROEL
  • HSP60
  • HSP65
  • SPG13
  • HSP-60
  • HuCHA60
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
1
hub protein
1
interacting protein
1
molecular function
1
biological process
0.99


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3996.9   (req: < 5)
Gene RIFs: 192   (req: <= 3)
Antibodies: 2113   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3996.9   (req: >= 5)
Gene RIFs: 192   (req: > 3)
Antibodies: 2113   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 65
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (55)
Gene expression (Transcription) (R-HSA-74160)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 7
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Gene expression (Transcription)
Reactome
Generic Transcription Pathway
Reactome
Mitochondrial protein import
Reactome
Protein localization
Reactome
RNA Polymerase II Transcription
Name
Explore in Pharos
Explore in Source
Gene expression (Transcription)
Generic Transcription Pathway
Mitochondrial protein import
Protein localization
RNA Polymerase II Transcription
Gene Ontology Terms (88)
Items per page:
10
1 – 10 of 19
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
MGI
Inferred from Direct Assay (IDA)
CAFA
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Physical Interaction (IPI)
CAFA
Inferred from Physical Interaction (IPI)
CAFA
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
CAFA
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
ParkinsonsUK-UCL
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Protein-Protein Interactions (511)
1 – 10 of 511
ACSF3
Tbio
Family: Enzyme
Novelty: 0.06563681
p_int: 0.999998627
p_ni: 0.000001373
Score: 0.187
Data Source: BioPlex,STRINGDB
TRMU
Tbio
Family: Enzyme
Novelty: 0.00469463
p_int: 0.999981638
p_ni: 0.000018336
p_wrong: 2.6e-8
Score: 0.262
Data Source: BioPlex,STRINGDB
ACSS1
Tbio
Family: Enzyme
Novelty: 0.03182902
p_int: 0.999975207
p_ni: 0.000024603
p_wrong: 1.9e-7
Score: 0.563
Data Source: BioPlex,STRINGDB
TAZ
Tbio
Novelty: 0.00236739
p_int: 0.99997226
p_ni: 0.00002774
Score: 0.912
Data Source: BioPlex,STRINGDB
LRRC28
Tdark
Novelty: 1.42312579
p_int: 0.999970779
p_ni: 0.000029221
Score: 0.173
Data Source: BioPlex,STRINGDB
FECH
Tbio
Family: Enzyme
Novelty: 0.00199177
p_int: 0.999965195
p_ni: 0.000034805
Score: 0.522
Data Source: BioPlex,STRINGDB
SDR39U1
Tbio
Family: Enzyme
Novelty: 0.09932641
p_int: 0.999941146
p_ni: 0.000001008
p_wrong: 0.000057846
Score: 0.182
Data Source: BioPlex,STRINGDB
SLC25A39
Tdark
Family: Transporter
Novelty: 0.349619
p_int: 0.999902644
p_ni: 2.75e-7
p_wrong: 0.000097081
Score: 0.275
Data Source: BioPlex,STRINGDB
GTPBP8
Tdark
Novelty: 6.51162791
p_int: 0.999810172
p_ni: 0.000189828
Score: 0.155
Data Source: BioPlex,STRINGDB
NUDT19
Tdark
Novelty: 0.49304543
p_int: 0.999676558
p_ni: 0.000323439
p_wrong: 3e-9
Score: 0.232
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  3996.90

PubMed score by year
PubTator Score  2418.75

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MLRLPTVFRQMRPVSRVLAPHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGS
1-70
PKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEI
70-140
RRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDKEIGNIISDAMKKVGRKGVITVKDGKTLNDE
140-210
LEIIEGMKFDRGYISPYFINTSKGQKCEFQDAYVLLSEKKISSIQSIVPALEIANAHRKPLVIIAEDVDG
210-280
EALSTLVLNRLKVGLQVVAVKAPGFGDNRKNQLKDMAIATGGAVFGEEGLTLNLEDVQPHDLGKVGEVIV
280-350
TKDDAMLLKGKGDKAQIEKRIQEIIEQLDVTTSEYEKEKLNERLAKLSDGVAVLKVGGTSDVEVNEKKDR
350-420
VTDALNATRAAVEEGIVLGGGCALLRCIPALDSLTPANEDQKIGIEIIKRTLKIPAMTIAKNAGVEGSLI
420-490
VEKIMQSSSEVGYDAMAGDFVNMVEKGIIDPTKVVRTALLDAAGVASLLTTAEVVVTEIPKEEKDPGMGA
490-560
MGGMGGGMGGGMF
560-573
MLRLPTVFRQMRPVSRVLAPHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDKEIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQDAYVLLSEKKISSIQSIVPALEIANAHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVAVKAPGFGDNRKNQLKDMAIATGGAVFGEEGLTLNLEDVQPHDLGKVGEVIVTKDDAMLLKGKGDKAQIEKRIQEIIEQLDVTTSEYEKEKLNERLAKLSDGVAVLKVGGTSDVEVNEKKDRVTDALNATRAAVEEGIVLGGGCALLRCIPALDSLTPANEDQKIGIEIIKRTLKIPAMTIAKNAGVEGSLIVEKIMQSSSEVGYDAMAGDFVNMVEKGIIDPTKVVRTALLDAAGVASLLTTAEVVVTEIPKEEKDPGMGAMGGMGGGMGGGMF