You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
TMEM266
Transmembrane protein 266

Protein Summary
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000388942
  • ENSP00000373594
  • ENSG00000169758

Symbol
  • C15orf27
  • HVRP1
  • C15orf27
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0
biological term
0
cell line
0
cell type or tissue
0
cellular component
0


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.5   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 100   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.5   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 100   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (3)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
HPA
Inferred from Direct Assay (IDA)
HPA
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (14)
1 – 10 of 14
RABEP1
Tbio
Family: Enzyme
Novelty: 0.03041026
p_int: 0.999834171
p_ni: 0.000165829
Score: 0.188
Data Source: BioPlex,STRINGDB
VPS11
Tbio
Novelty: 0.00679612
p_int: 0.999380288
p_ni: 0.000619712
Score: 0.795
Data Source: BioPlex,STRINGDB
TGFBRAP1
Tbio
Novelty: 0.09004245
p_int: 0.997269745
p_ni: 0.002730214
p_wrong: 4.1e-8
Score: 0.802
Data Source: BioPlex,STRINGDB
STX5
Tbio
Novelty: 0.01314285
p_int: 0.992022722
p_ni: 0.007977278
Data Source: BioPlex
FBXO28
Tbio
Novelty: 0.12833512
p_int: 0.911408334
p_ni: 0.088591664
p_wrong: 2e-9
Data Source: BioPlex
EDRF1
Tdark
Novelty: 0.32061069
p_int: 0.89649482
p_ni: 0.103486123
p_wrong: 0.000019057
Score: 0.183
Data Source: BioPlex,STRINGDB
WDR20
Tbio
Novelty: 0.00178364
p_int: 0.888586962
p_ni: 0.111413023
p_wrong: 1.5e-8
Score: 0.163
Data Source: BioPlex,STRINGDB
HM13
Tbio
Family: Enzyme
Novelty: 0.00293485
p_int: 0.882619123
p_ni: 0.117380877
Score: 0.359
Data Source: BioPlex,STRINGDB
KCMF1
Tbio
Family: Enzyme
Novelty: 0.03549246
p_int: 0.872431835
p_ni: 0.127568161
p_wrong: 4e-9
Score: 0.192
Data Source: BioPlex,STRINGDB
KDM1A
Tchem
Family: Epigenetic
Novelty: 0.00170368
p_int: 0.778271764
p_ni: 0.221728236
Score: 0.188
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  1.50

PubMed score by year
PubTator Score  0.5

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAVAPSFNMTNPQPAIEGGISEVEIISQQVDEETKSIAPVQLVNFAYRDLPLAAVDLSTAGSQLLSNLDE
1-70
DYQREGSNWLKPCCGKRAAVWQVFLLSASLNSFLVACVILVVILLTLELLIDIKLLQFSSAFQFAGVIHW
70-140
ISLVILSVFFSETVLRIVVLGIWDYIENKIEVFDGAVIILSLAPMVASTVANGPRSPWDAISLIIMLRIW
140-210
RVKRVIDAYVLPVKLEMEMVIQQYEKAKVIQDEQLERLTQICQEQGFEIRQLRAHLAQQDLDLAAEREAA
210-280
LQAPHVLSQPRSRFKVLEAGTWDEETAAESVVEELQPSQEATMKDDMNSYISQYYNGPSSDSGVPEPAVC
280-350
MVTTAAIDIHQPNISSDLFSLDMPLKLGGNGTSATSESASRSSVTRAQSDSSQTLGSSMDCSTAREEPSS
350-420
EPGPSPPPLPSQQQVEEATVQDLLSSLSEDPCPSQKALDPAPLARPSPAGSAQTSPELEHRVSLFNQKNQ
420-490
EGFTVFQIRPVIHFQPTVPMLEDKFRSLESKEQKLHRVPEA
490-531
MAVAPSFNMTNPQPAIEGGISEVEIISQQVDEETKSIAPVQLVNFAYRDLPLAAVDLSTAGSQLLSNLDEDYQREGSNWLKPCCGKRAAVWQVFLLSASLNSFLVACVILVVILLTLELLIDIKLLQFSSAFQFAGVIHWISLVILSVFFSETVLRIVVLGIWDYIENKIEVFDGAVIILSLAPMVASTVANGPRSPWDAISLIIMLRIWRVKRVIDAYVLPVKLEMEMVIQQYEKAKVIQDEQLERLTQICQEQGFEIRQLRAHLAQQDLDLAAEREAALQAPHVLSQPRSRFKVLEAGTWDEETAAESVVEELQPSQEATMKDDMNSYISQYYNGPSSDSGVPEPAVCMVTTAAIDIHQPNISSDLFSLDMPLKLGGNGTSATSESASRSSVTRAQSDSSQTLGSSMDCSTAREEPSSEPGPSPPPLPSQQQVEEATVQDLLSSLSEDPCPSQKALDPAPLARPSPAGSAQTSPELEHRVSLFNQKNQEGFTVFQIRPVIHFQPTVPMLEDKFRSLESKEQKLHRVPEA