You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
KRT18
Keratin, type I cytoskeletal 18

Protein Summary
Description
Involved in the uptake of thrombin-antithrombin complexes by hepatic cells (By similarity). When phosphorylated, plays a role in filament reorganization. Involved in the delivery of mutated CFTR to the plasma membrane. Together with KRT8, is involved in interleukin-6 (IL-6)-mediated barrier protection. KRT18 encodes the type I intermediate filament chain keratin 18. Keratin 18, together with its filament partner keratin 8, are perhaps the most commonly found members of the intermediate filament gene family. They are expressed in single layer epithelial tissues of the body. Mutations in this gene have been linked to cryptogenic cirrhosis. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000388835
  • ENSP00000373487
  • ENSG00000111057
  • ENST00000388837
  • ENSP00000373489

Symbol
  • CYK18
  • K18
  • CK-18
  • CYK18
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
hub protein
0.99
interacting protein
0.99
kinase perturbation
0.98
transcription factor perturbation
0.98
gene perturbation
0.97


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1110.28   (req: < 5)
Gene RIFs: 164   (req: <= 3)
Antibodies: 3147   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1110.28   (req: >= 5)
Gene RIFs: 164   (req: > 3)
Antibodies: 3147   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 15
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (24)
Developmental Biology (R-HSA-1266738)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 2 of 2
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Developmental Biology
Reactome
Keratinization
Name
Explore in Pharos
Explore in Source
Developmental Biology
Keratinization
Protein-Protein Interactions (179)
1 – 10 of 179
KRT8
Tbio
Novelty: 0.00128652
Score: 0.997
Data Source: STRINGDB
KRT5
Tbio
Novelty: 0.00122484
Score: 0.962
Data Source: STRINGDB
KRT19
Tbio
Novelty: 0.00055202
Score: 0.956
Data Source: STRINGDB
KRT7
Tbio
Novelty: 0.00064709
Score: 0.956
Data Source: STRINGDB
CASP6
Tchem
Family: Enzyme
Novelty: 0.00311641
Score: 0.947
Data Source: STRINGDB
KRT6A
Tbio
Novelty: 0.01158599
Score: 0.935
Data Source: STRINGDB
KRT4
Tbio
Novelty: 0.00704461
Score: 0.935
Data Source: STRINGDB
KRT3
Tbio
Novelty: 0.00669689
Score: 0.934
Data Source: STRINGDB
KRT72
Tbio
Novelty: 0.13561378
Score: 0.933
Data Source: STRINGDB
KRT76
Tdark
Novelty: 0.28919492
Score: 0.93
Data Source: STRINGDB
Publication Statistics
PubMed Score  1110.28

PubMed score by year
PubTator Score  1086.91

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSFTTRSTFSTNYRSLGSVQAPSYGARPVSSAASVYAGAGGSGSRISVSRSTSFRGGMGSGGLATGIAGG
1-70
LAGMGGIQNEKETMQSLNDRLASYLDRVRSLETENRRLESKIREHLEKKGPQVRDWSHYFKIIEDLRAQI
70-140
FANTVDNARIVLQIDNARLAADDFRVKYETELAMRQSVENDIHGLRKVIDDTNITRLQLETEIEALKEEL
140-210
LFMKKNHEEEVKGLQAQIASSGLTVEVDAPKSQDLAKIMADIRAQYDELARKNREELDKYWSQQIEESTT
210-280
VVTTQSAEVGAAETTLTELRRTVQSLEIDLDSMRNLKASLENSLREVEARYALQMEQLNGILLHLESELA
280-350
QTRAEGQRQAQEYEALLNIKVKLEAEIATYRRLLEDGEDFNLGDALDSSNSMQTIQKTTTRRIVDGKVVS
350-420
ETNDTKVLRH
420-430
MSFTTRSTFSTNYRSLGSVQAPSYGARPVSSAASVYAGAGGSGSRISVSRSTSFRGGMGSGGLATGIAGGLAGMGGIQNEKETMQSLNDRLASYLDRVRSLETENRRLESKIREHLEKKGPQVRDWSHYFKIIEDLRAQIFANTVDNARIVLQIDNARLAADDFRVKYETELAMRQSVENDIHGLRKVIDDTNITRLQLETEIEALKEELLFMKKNHEEEVKGLQAQIASSGLTVEVDAPKSQDLAKIMADIRAQYDELARKNREELDKYWSQQIEESTTVVTTQSAEVGAAETTLTELRRTVQSLEIDLDSMRNLKASLENSLREVEARYALQMEQLNGILLHLESELAQTRAEGQRQAQEYEALLNIKVKLEAEIATYRRLLEDGEDFNLGDALDSSNSMQTIQKTTTRRIVDGKVVSETNDTKVLRH