You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
DMRT1
Doublesex- and mab-3-related transcription factor 1

Protein Summary
Description
Transcription factor that plays a key role in male sex determination and differentiation by controlling testis development and male germ cell proliferation. Plays a central role in spermatogonia by inhibiting meiosis in undifferentiated spermatogonia and promoting mitosis, leading to spermatogonial development and allowing abundant and continuous production of sperm. Acts both as a transcription repressor and activator: prevents meiosis by restricting retinoic acid (RA)-dependent transcription and repressing STRA8 expression and promotes spermatogonial development by activating spermatogonial differentiation genes, such as SOHLH1. Also plays a key role in postnatal sex maintenance by maintaining testis determination and preventing feminization: represses transcription of female promoting genes such as FOXL2 and activates male-specific genes. May act as a tumor suppressor. May also play a minor role in oogenesis (By similarity). This gene is found in a cluster with two other members of ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000382276
  • ENSP00000371711
  • ENSG00000137090

Symbol
  • DMT1
  • DMT1
  • CT154
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.95
trait
0.86
molecular function
0.84
PubMedID
0.67
gene perturbation
0.65


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 219.32   (req: < 5)
Gene RIFs: 18   (req: <= 3)
Antibodies: 278   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 219.32   (req: >= 5)
Gene RIFs: 18   (req: > 3)
Antibodies: 278   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 26
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (28)
Items per page:
10
1 – 9 of 9
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
IntAct
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence Alignment (ISA)
NTNU_SB
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (92)
1 – 10 of 92
AMH
Tbio
Novelty: 0.0003157
Score: 0.897
Data Source: STRINGDB
FOXL2
Tbio
Family: TF
Novelty: 0.00136796
Score: 0.888
Data Source: STRINGDB
KANK1
Tbio
Novelty: 0.02567682
Score: 0.811
Data Source: STRINGDB
STRA8
Tbio
Novelty: 0.01091211
Score: 0.797
Data Source: STRINGDB
CYP19A1
Tclin
Family: Enzyme
Novelty: 0.0003927
Score: 0.79
Data Source: STRINGDB
SOX9
Tbio
Family: TF
Novelty: 0.00058844
Score: 0.777
Data Source: STRINGDB
SOX3
Tbio
Family: TF
Novelty: 0.00443141
Score: 0.767
Data Source: STRINGDB
WNT4
Tbio
Novelty: 0.00374656
Score: 0.763
Data Source: STRINGDB
DOCK8
Tbio
Novelty: 0.00796871
Score: 0.757
Data Source: STRINGDB
NANOS3
Tbio
Novelty: 0.0228214
Score: 0.743
Data Source: STRINGDB
Publication Statistics
PubMed Score  219.32

PubMed score by year
PubTator Score  198.79

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPNDEAFSKPSTPSEAPHAPGVPPQGRAGGFGKASGALVGAASGSSAGGSSRGGGSGSGASDLGAGSKKS
1-70
PRLPKCARCRNHGYASPLKGHKRFCMWRDCQCKKCNLIAERQRVMAAQVALRRQQAQEEELGISHPIPLP
70-140
SAAELLVKRENNGSNPCLMTECSGTSQPPPASVPTTAASEGRMVIQDIPAVTSRGHVENTPDLVSDSTYY
140-210
SSFYQPSLFPYYNNLYNCPQYSMALAADSASGEVGNPLGGSPVKNSLRGLPGPYVPGQTGNQWQMKNMEN
210-280
RHAMSSQYRMHSYYPPPSYLGQSVPQFFTFEDAPSYPEARASVFSPPSSQDSGLVSLSSSSPISNKSTKA
280-350
VLECEPASEPSSFTVTPVIEEDE
350-373
MPNDEAFSKPSTPSEAPHAPGVPPQGRAGGFGKASGALVGAASGSSAGGSSRGGGSGSGASDLGAGSKKSPRLPKCARCRNHGYASPLKGHKRFCMWRDCQCKKCNLIAERQRVMAAQVALRRQQAQEEELGISHPIPLPSAAELLVKRENNGSNPCLMTECSGTSQPPPASVPTTAASEGRMVIQDIPAVTSRGHVENTPDLVSDSTYYSSFYQPSLFPYYNNLYNCPQYSMALAADSASGEVGNPLGGSPVKNSLRGLPGPYVPGQTGNQWQMKNMENRHAMSSQYRMHSYYPPPSYLGQSVPQFFTFEDAPSYPEARASVFSPPSSQDSGLVSLSSSSPISNKSTKAVLECEPASEPSSFTVTPVIEEDE