You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
THUMPD1
THUMP domain-containing protein 1

Protein Summary
Description
Functions as a tRNA-binding adapter to mediate NAT10-dependent tRNA acetylation (PubMed:25653167).
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000381337
  • ENSP00000370741
  • ENSG00000066654
  • ENST00000396083
  • ENSP00000379392
  • ENST00000636554
  • ENSP00000490841

Symbol
  • Tan1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
0.98
kinase perturbation
0.84
transcription factor binding site profile
0.79
transcription factor perturbation
0.74
virus perturbation
0.72


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 664.66   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 117   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 664.66   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 117   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (4)
Metabolism of RNA (R-HSA-8953854)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism of RNA
Reactome
rRNA modification in the nucleus and cytosol
Reactome
rRNA processing
Reactome
rRNA processing in the nucleus and cytosol
Name
Explore in Pharos
Explore in Source
Metabolism of RNA
rRNA modification in the nucleus and cytosol
rRNA processing
rRNA processing in the nucleus and cytosol
Gene Ontology Terms (4)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Protein-Protein Interactions (55)
1 – 10 of 55
PUS7
Tbio
Family: Enzyme
Novelty: 0.08979913
p_int: 0.99999992
p_ni: 7.7e-8
p_wrong: 3e-9
Score: 0.717
Data Source: BioPlex,STRINGDB
QTRT1
Tbio
Family: Enzyme
Novelty: 0.06198347
p_int: 0.999998026
p_ni: 0.000001918
p_wrong: 5.6e-8
Score: 0.27
Data Source: BioPlex,STRINGDB
FDXACB1
Tdark
p_int: 0.999962446
p_ni: 0.000022334
p_wrong: 0.00001522
Score: 0.579
Data Source: BioPlex,STRINGDB
ZC3H8
Tbio
Novelty: 0.6
p_int: 0.999471298
p_ni: 0.000528702
Score: 0.188
Data Source: BioPlex,STRINGDB
NAT10
Tbio
Family: Enzyme
Novelty: 0.01368279
p_int: 0.998925479
p_ni: 0.001074521
Score: 0.993
Data Source: BioPlex,Reactome,STRINGDB
PUS1
Tbio
Family: Enzyme
Novelty: 0.02324552
p_int: 0.998655509
p_ni: 0.001344491
Score: 0.366
Data Source: BioPlex,STRINGDB
CCL26
Tbio
Novelty: 0.00781664
p_int: 0.997825087
p_ni: 0.001989666
p_wrong: 0.000185247
Data Source: BioPlex
LUM
Tbio
Novelty: 0.00157768
p_int: 0.915294509
p_ni: 0.081907702
p_wrong: 0.002797789
Score: 0.237
Data Source: BioPlex,STRINGDB
TAS2R41
Tdark
Family: GPCR
Novelty: 1.05263158
p_int: 0.80520028
p_ni: 0.014481014
p_wrong: 0.180318707
Score: 0.165
Data Source: BioPlex,STRINGDB
YBX1
Tbio
Family: TF
Novelty: 0.00147127
p_int: 0.76503938
p_ni: 0.23496062
Score: 0.182
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  664.66

PubMed score by year
PubTator Score  1.98

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAAPAQQTTQPGGGKRKGKAQYVLAKRARRCDAGGPRQLEPGLQGILITCNMNERKCVEEAYSLLNEYGD
1-70
DMYGPEKFTDKDQQPSGSEGEDDDAEAALKKEVGDIKASTEMRLRRFQSVESGANNVVFIRTLGIEPEKL
70-140
VHHILQDMYKTKKKKTRVILRMLPISGTCKAFLEDMKKYAETFLEPWFKAPNKGTFQIVYKSRNNSHVNR
140-210
EEVIRELAGIVCTLNSENKVDLTNPQYTVVVEIIKAVCCLSVVKDYMLFRKYNLQEVVKSPKDPSQLNSK
210-280
QGNGKEAKLESADKSDQNNTAEGKNNQQVPENTEELGQTKPTSNPQVVNEGGAKPELASQATEGSKSNEN
280-350
DFS
350-353
MAAPAQQTTQPGGGKRKGKAQYVLAKRARRCDAGGPRQLEPGLQGILITCNMNERKCVEEAYSLLNEYGDDMYGPEKFTDKDQQPSGSEGEDDDAEAALKKEVGDIKASTEMRLRRFQSVESGANNVVFIRTLGIEPEKLVHHILQDMYKTKKKKTRVILRMLPISGTCKAFLEDMKKYAETFLEPWFKAPNKGTFQIVYKSRNNSHVNREEVIRELAGIVCTLNSENKVDLTNPQYTVVVEIIKAVCCLSVVKDYMLFRKYNLQEVVKSPKDPSQLNSKQGNGKEAKLESADKSDQNNTAEGKNNQQVPENTEELGQTKPTSNPQVVNEGGAKPELASQATEGSKSNENDFS