You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
AMELX
Amelogenin, X isoform

Protein Summary
Description
Plays a role in biomineralization. Seems to regulate the formation of crystallites during the secretory stage of tooth enamel development. Thought to play a major role in the structural organization and mineralization of developing enamel. This gene encodes a member of the amelogenin family of extracellular matrix proteins. Amelogenins are involved in biomineralization during tooth enamel development. Mutations in this gene cause X-linked amelogenesis imperfecta. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000348912
  • ENSP00000335312
  • ENSG00000125363
  • ENST00000380712
  • ENSP00000370088
  • ENST00000380714
  • ENSP00000370090

Symbol
  • AMG
  • AMGX
  • AMG
  • AI1E
  • AIH1
  • ALGN
  • AMGL
  • AMGX
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell type or tissue
0.62
biological term
0.56
biological process
0.51
disease
0.51
tissue
0.47


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1300.57   (req: < 5)
Gene RIFs: 40   (req: <= 3)
Antibodies: 147   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1300.57   (req: >= 5)
Gene RIFs: 40   (req: > 3)
Antibodies: 147   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 21
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (4)
Metabolism of proteins (R-HSA-392499)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism of proteins
Reactome
Post-translational protein modification
Reactome
Post-translational protein phosphorylation
Reactome
Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Name
Explore in Pharos
Explore in Source
Metabolism of proteins
Post-translational protein modification
Post-translational protein phosphorylation
Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Protein-Protein Interactions (163)
1 – 10 of 163
ENAM
Tbio
Novelty: 0.00705934
Score: 0.995
Data Source: STRINGDB
AMBN
Tbio
Novelty: 0.00438592
Score: 0.995
Data Source: STRINGDB
FGA
Tbio
Novelty: 0.00122914
Score: 0.983
Data Source: STRINGDB
AMTN
Tbio
Novelty: 0.03727359
Score: 0.982
Data Source: STRINGDB
FAM20C
Tbio
Family: Enzyme
Novelty: 0.004596
Score: 0.974
Data Source: STRINGDB
FAM20A
Tbio
Family: Enzyme
Novelty: 0.04341038
Score: 0.963
Data Source: STRINGDB
SPP1
Tbio
Novelty: 0.00020502
Score: 0.945
Data Source: STRINGDB
MEPE
Tbio
Novelty: 0.00827573
Score: 0.941
Data Source: STRINGDB
SPARCL1
Tbio
Novelty: 0.01525848
Score: 0.94
Data Source: STRINGDB
DMP1
Tbio
Novelty: 0.01960235
Score: 0.938
Data Source: STRINGDB
Publication Statistics
PubMed Score  1300.57

PubMed score by year
PubTator Score  197.66

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGTWILFACLLGAAFAMPLPPHPGHPGYINFSYEVLTPLKWYQSIRPPYPSYGYEPMGGWLHHQIIPVLS
1-70
QQHPPTHTLQPHHHIPVVPAQQPVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPM
70-140
QPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD
140-191
MGTWILFACLLGAAFAMPLPPHPGHPGYINFSYEVLTPLKWYQSIRPPYPSYGYEPMGGWLHHQIIPVLSQQHPPTHTLQPHHHIPVVPAQQPVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD