You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
SHBG
Sex hormone-binding globulin

Protein Summary
Description
Functions as an androgen transport protein, but may also be involved in receptor mediated processes. Each dimer binds one molecule of steroid. Specific for 5-alpha-dihydrotestosterone, testosterone, and 17-beta-estradiol. Regulates the plasma metabolic clearance rate of steroid hormones by controlling their plasma concentration. This gene encodes a steroid binding protein that was first described as a plasma protein secreted by the liver but is now thought to participate in the regulation of steroid responses. The encoded protein transports androgens and estrogens in the blood, binding each steroid molecule as a dimer formed from identical or nearly identical monomers. Polymorphisms in this gene have been associated with polycystic ovary syndrome and type 2 diabetes mellitus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000380450
  • ENSP00000369816
  • ENSG00000129214
  • ENST00000416273
  • ENSP00000388867
  • ENST00000441599
  • ENSP00000393426
  • ENST00000575903
  • ENSP00000458973

Symbol
  • ABP
  • SBP
  • TEBG
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological term
0.96
chemical
0.96
cell type or tissue
0.83
drug
0.75
disease
0.7


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5211.43   (req: < 5)
Gene RIFs: 234   (req: <= 3)
Antibodies: 652   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5211.43   (req: >= 5)
Gene RIFs: 234   (req: > 3)
Antibodies: 652   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 57
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 30
Protein Data Bank (9)
1 – 5 of 9
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (4)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (94)
1 – 10 of 94
TMEM236
Tdark
Novelty: 10
p_int: 0.993891179
p_ni: 0.006108818
p_wrong: 3e-9
Score: 0.68
Data Source: BioPlex,STRINGDB
CNTNAP3B
Tdark
Novelty: 0.3692932
p_int: 0.894770377
p_ni: 0.105229617
p_wrong: 6e-9
Score: 0.288
Data Source: BioPlex,STRINGDB
GNB2
Tbio
Novelty: 0.20536996
p_int: 0.886393472
p_ni: 0.113605584
p_wrong: 9.44e-7
Score: 0.185
Data Source: BioPlex,STRINGDB
SULT2A1
Tbio
Family: Enzyme
Novelty: 0.00305442
Score: 0.921
Data Source: STRINGDB
INS
Tbio
Novelty: 0.00000614
Score: 0.869
Data Source: STRINGDB
PRL
Tbio
Novelty: 0.00010121
Score: 0.86
Data Source: STRINGDB
SERPINA6
Tchem
Novelty: 0.00066907
Score: 0.839
Data Source: STRINGDB
CYP19A1
Tclin
Family: Enzyme
Novelty: 0.0003927
Score: 0.796
Data Source: STRINGDB
IGF1
Tbio
Novelty: 0.00004544
Score: 0.788
Data Source: STRINGDB
AR
Tclin
Family: NR
Novelty: 0.00013834
Score: 0.742
Data Source: STRINGDB
Publication Statistics
PubMed Score  5211.43

PubMed score by year
PubTator Score  4676.04

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MESRGPLATSRLLLLLLLLLLRHTRQGWALRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLTKITKTS
1-70
SSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDS
70-140
VLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASA
140-210
PTSLRSCDVESNPGIFLPPGTQAEFNLRDIPQPHAEPWAFSLDLGLKQAAGSGHLLALGTPENPSWLSLH
210-280
LQDQKVVLSSGSGPGLDLPLVLGLPLQLKLSMSRVVLSQGSKMKALALPPLGLAPLLNLWAKPQGRLFLG
280-350
ALPGEDSSTSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASH
350-402
MESRGPLATSRLLLLLLLLLLRHTRQGWALRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSCDVESNPGIFLPPGTQAEFNLRDIPQPHAEPWAFSLDLGLKQAAGSGHLLALGTPENPSWLSLHLQDQKVVLSSGSGPGLDLPLVLGLPLQLKLSMSRVVLSQGSKMKALALPPLGLAPLLNLWAKPQGRLFLGALPGEDSSTSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASH