You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
LY86
Lymphocyte antigen 86

Protein Summary
Description
May cooperate with CD180 and TLR4 to mediate the innate immune response to bacterial lipopolysaccharide (LPS) and cytokine production. Important for efficient CD180 cell surface expression (By similarity).
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000230568
  • ENSP00000230568
  • ENSG00000112799
  • ENST00000379953
  • ENSP00000369286

Symbol
  • MD1
  • MD1
  • MD-1
  • MMD-1
  • dJ80N2.1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.92
tissue sample
0.7
transcription factor perturbation
0.68
kinase perturbation
0.66
disease perturbation
0.62


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 607.09   (req: < 5)
Gene RIFs: 10   (req: <= 3)
Antibodies: 341   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 607.09   (req: >= 5)
Gene RIFs: 10   (req: > 3)
Antibodies: 341   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (4)
Immune System (R-HSA-168256)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Immune System
Reactome
Innate Immune System
Reactome
Toll Like Receptor 4 (TLR4) Cascade
Reactome
Toll-like Receptor Cascades
Name
Explore in Pharos
Explore in Source
Immune System
Innate Immune System
Toll Like Receptor 4 (TLR4) Cascade
Toll-like Receptor Cascades
Gene Ontology Terms (8)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
UniProtKB-SubCell
Protein-Protein Interactions (190)
1 – 10 of 190
NBR1
Tbio
Novelty: 0.0159538
p_int: 0.999976102
p_ni: 0.000023898
Data Source: BioPlex
VEGFB
Tclin
Novelty: 0.00363465
p_int: 0.999636023
p_ni: 0.000041017
p_wrong: 0.00032296
Data Source: BioPlex
RAC3
Tbio
Family: Enzyme
Novelty: 0.05044614
p_int: 0.999083264
p_ni: 0.000620223
p_wrong: 0.000296513
Data Source: BioPlex
CD55
Tbio
Novelty: 0.00064328
p_int: 0.998055158
p_ni: 0.001831187
p_wrong: 0.000113654
Data Source: BioPlex
SPON1
Tbio
Novelty: 0.00388947
p_int: 0.99760595
p_ni: 0.000222411
p_wrong: 0.002171638
Data Source: BioPlex
CTSF
Tchem
Family: Enzyme
Novelty: 0.02020345
p_int: 0.99556122
p_ni: 0.004436875
p_wrong: 0.000001905
Data Source: BioPlex
DCP2
Tbio
Family: Enzyme
Novelty: 0.00984421
p_int: 0.995506745
p_ni: 0.004492265
p_wrong: 9.9e-7
Data Source: BioPlex
SAMD1
Tdark
Novelty: 0.65934066
p_int: 0.99515147
p_ni: 0.004848464
p_wrong: 6.7e-8
Data Source: BioPlex
PXYLP1
Tbio
Family: Enzyme
Novelty: 0.00920316
p_int: 0.994850179
p_ni: 0.005148025
p_wrong: 0.000001796
Data Source: BioPlex
RPL23
Tbio
Novelty: 0.02634055
p_int: 0.99463449
p_ni: 0.00536551
Data Source: BioPlex
Publication Statistics
PubMed Score  607.09

PubMed score by year
PubTator Score  6.7

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MKGFTATLFLWTLIFPSCSGGGGGKAWPTHVVCSDSGLEVLYQSCDPLQDFGFSVEKCSKQLKSNINIRF
1-70
GIILREDIKELFLDLALMSQGSSVLNFSYPICEAALPKFSFCGRRKGEQIYYAGPVNNPEFTIPQGEYQV
70-140
LLELYTEKRSTVACANATIMCS
140-162
MKGFTATLFLWTLIFPSCSGGGGGKAWPTHVVCSDSGLEVLYQSCDPLQDFGFSVEKCSKQLKSNINIRFGIILREDIKELFLDLALMSQGSSVLNFSYPICEAALPKFSFCGRRKGEQIYYAGPVNNPEFTIPQGEYQVLLELYTEKRSTVACANATIMCS