You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
INSL3
Insulin-like 3

Protein Classes
Protein Summary
Description
Seems to play a role in testicular function. May be a trophic hormone with a role in testicular descent in fetal life. Is a ligand for LGR8 receptor. This gene encodes a member of the insulin-like hormone superfamily. The encoded protein is mainly produced in gonadal tissues. Studies of the mouse counterpart suggest that this gene may be involved in the development of urogenital tract and female fertility. This protein may also act as a hormone to regulate growth and differentiation of gubernaculum, and thus mediating intra-abdominal testicular descent. Mutations in this gene may lead to cryptorchidism. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2012]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000317306
  • ENSP00000321724
  • ENSG00000248099
  • ENST00000379695
  • ENSP00000369017

Symbol
  • RLF
  • RLNL
  • RLF
  • RLNL
  • ley-I-L
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.75
biological term
0.72
PubMedID
0.64
tissue sample
0.57
disease perturbation
0.56


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 266.72   (req: < 5)
Gene RIFs: 68   (req: <= 3)
Antibodies: 180   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 266.72   (req: >= 5)
Gene RIFs: 68   (req: > 3)
Antibodies: 180   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 11
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (11)
Class A/1 (Rhodopsin-like receptors) (R-HSA-373076)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Class A/1 (Rhodopsin-like receptors)
Reactome
G alpha (s) signalling events
Reactome
GPCR downstream signalling
Reactome
GPCR ligand binding
Reactome
Peptide ligand-binding receptors
Name
Explore in Pharos
Explore in Source
Class A/1 (Rhodopsin-like receptors)
G alpha (s) signalling events
GPCR downstream signalling
GPCR ligand binding
Peptide ligand-binding receptors
Protein-Protein Interactions (162)
1 – 10 of 162
MTERF4
Tbio
Novelty: 0.21242356
p_int: 0.999982617
p_ni: 0.000017274
p_wrong: 1.09e-7
Score: 0.261
Data Source: BioPlex,STRINGDB
NSUN4
Tbio
Family: Enzyme
Novelty: 0.42211055
p_int: 0.999679967
p_ni: 0.000320029
p_wrong: 4e-9
Score: 0.209
Data Source: BioPlex,STRINGDB
RNF123
Tbio
Family: Enzyme
Novelty: 0.04581752
p_int: 0.974728482
p_ni: 0.025271518
Score: 0.529
Data Source: BioPlex,STRINGDB
IREB2
Tbio
Novelty: 0.00409023
p_int: 0.970086677
p_ni: 0.029878484
p_wrong: 0.000034839
Score: 0.219
Data Source: BioPlex,STRINGDB
UBAC1
Tbio
Novelty: 0.00195339
p_int: 0.927875625
p_ni: 0.072124375
p_wrong: 1e-9
Score: 0.489
Data Source: BioPlex,STRINGDB
CHAF1B
Tbio
Novelty: 0.07516336
p_int: 0.901943541
p_ni: 0.098056459
Score: 0.513
Data Source: BioPlex,STRINGDB
GAPDHS
Tbio
Family: Enzyme
Novelty: 0.01313187
p_int: 0.828979926
p_ni: 0.171019899
p_wrong: 1.75e-7
Score: 0.156
Data Source: BioPlex,STRINGDB
RXFP2
Tbio
Family: GPCR
Novelty: 0.01111071
Score: 0.997
Data Source: Reactome,STRINGDB
RXFP1
Tchem
Family: GPCR
Novelty: 0.00590091
Score: 0.983
Data Source: STRINGDB
RLN3
Tbio
Novelty: 0.01243441
Score: 0.978
Data Source: STRINGDB
Publication Statistics
PubMed Score  266.72

PubMed score by year
PubTator Score  182.74

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDPRLPAWALVLLGPALVFALGPAPTPEMREKLCGHHFVRALVRVCGGPRWSTEARRPATGGDRELLQWL
1-70
ERRHLLHGLVADSNLTLGPGLQPLPQTSHHHRHHRAAATNPARYCCLSGCTQQDLLTLCPY
70-131
MDPRLPAWALVLLGPALVFALGPAPTPEMREKLCGHHFVRALVRVCGGPRWSTEARRPATGGDRELLQWLERRHLLHGLVADSNLTLGPGLQPLPQTSHHHRHHRAAATNPARYCCLSGCTQQDLLTLCPY