You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
GCM2
Chorion-specific transcription factor GCMb

Protein Summary
Description
Transcription factor that binds specific sequences on gene promoters and activate their transcription. Through the regulation of gene transcription, may play a role in parathyroid gland development. This gene is a homolog of the Drosophila glial cells missing gene, which is thought to act as a binary switch between neuronal and glial cell determination. The protein encoded by this gene contains a conserved N-terminal GCM motif that has DNA-binding activity. The protein is a transcription factor that acts as a master regulator of parathyroid development. It has been suggested that this transcription factor might mediate the effect of calcium on parathyroid hormone expression and secretion in parathyroid cells. Mutations in this gene are associated with hypoparathyroidism. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000379491
  • ENSP00000368805
  • ENSG00000124827

Symbol
  • GCMB
  • GCMB
  • HRPT4
  • hGCMb
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.72
cell type or tissue
0.66
PubMedID
0.61
tissue sample
0.53
microRNA
0.49


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 156.23   (req: < 5)
Gene RIFs: 21   (req: <= 3)
Antibodies: 113   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 156.23   (req: >= 5)
Gene RIFs: 21   (req: > 3)
Antibodies: 113   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 10
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (11)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Mutant Phenotype (IMP)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (41)
1 – 10 of 41
CSTF1
Tbio
Novelty: 0.11966948
p_int: 0.877114045
p_ni: 0.122885955
Score: 0.54
Data Source: BioPlex,STRINGDB
CASR
Tclin
Family: GPCR
Novelty: 0.00066875
Score: 0.845
Data Source: STRINGDB
GNA11
Tbio
Novelty: 0.00156526
Score: 0.783
Data Source: STRINGDB
SYCP2L
Tdark
Novelty: 0.28081123
Score: 0.737
Data Source: STRINGDB
FOXN1
Tbio
Family: TF
Novelty: 0.00425273
Score: 0.69
Data Source: STRINGDB
PTH
Tbio
Novelty: 0.00003793
Score: 0.682
Data Source: STRINGDB
GATA3
Tbio
Family: TF
Novelty: 0.00087325
Score: 0.658
Data Source: STRINGDB
PTH1R
Tclin
Family: GPCR
Novelty: 0.0018948
Score: 0.601
Data Source: STRINGDB
TRPV5
Tchem
Family: IC
Novelty: 0.00701642
Score: 0.596
Data Source: STRINGDB
TIMM17B
Tdark
Family: Enzyme
Novelty: 0.06372028
Score: 0.595
Data Source: STRINGDB
Publication Statistics
PubMed Score  156.23

PubMed score by year
PubTator Score  56.64

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPAAAVQEAVGVCSYGMQLSWDINDPQMPQELALFDQFREWPDGYVRFIYSSDEKKAQRHLSGWAMRNTN
1-70
NHNGHILKKSCLGVVVCTQACTLPDGSRLQLRPAICDKARLKQQKKACPNCHSALELIPCRGHSGYPVTN
70-140
FWRLDGNAIFFQAKGVHDHPRPESKSETEARRSAIKRQMASFYQPQKKRIRESEAEENQDSSGHFSNIPP
140-210
LENPEDFDIVTETSFPIPGQPCPSFPKSDVYKATCDLATFQGDKMPPFQKYSSPRIYLPRPPCSYELANP
210-280
GYTNSSPYPTLYKDSTSIPNDTDWVHLNTLQCNVNSYSSYERSFDFTNKQHGWKPALGKPSLVERTNHGQ
280-350
FQAMATRPYYNPELPCRYLTTPPPGAPALQTVITTTTKVSYQAYQPPAMKYSDSVREVKSLSSCNYAPED
350-420
TGMSVYPEPWGPPVTVTRAASPSGPPPMKIAGDCRAIRPTVAIPHEPVSSRTDEAETWDVCLSGLGSAVS
420-490
YSDRVGPFFTYNNEDF
490-506
MPAAAVQEAVGVCSYGMQLSWDINDPQMPQELALFDQFREWPDGYVRFIYSSDEKKAQRHLSGWAMRNTNNHNGHILKKSCLGVVVCTQACTLPDGSRLQLRPAICDKARLKQQKKACPNCHSALELIPCRGHSGYPVTNFWRLDGNAIFFQAKGVHDHPRPESKSETEARRSAIKRQMASFYQPQKKRIRESEAEENQDSSGHFSNIPPLENPEDFDIVTETSFPIPGQPCPSFPKSDVYKATCDLATFQGDKMPPFQKYSSPRIYLPRPPCSYELANPGYTNSSPYPTLYKDSTSIPNDTDWVHLNTLQCNVNSYSSYERSFDFTNKQHGWKPALGKPSLVERTNHGQFQAMATRPYYNPELPCRYLTTPPPGAPALQTVITTTTKVSYQAYQPPAMKYSDSVREVKSLSSCNYAPEDTGMSVYPEPWGPPVTVTRAASPSGPPPMKIAGDCRAIRPTVAIPHEPVSSRTDEAETWDVCLSGLGSAVSYSDRVGPFFTYNNEDF