You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ASPH
Aspartyl/asparaginyl beta-hydroxylase

Protein Summary
Description
Isoform 1: specifically hydroxylates an Asp or Asn residue in certain epidermal growth factor-like (EGF) domains of a number of proteins. Isoform 8: membrane-bound Ca(2+)-sensing protein, which is a structural component of the ER-plasma membrane junctions. Isoform 8 regulates the activity of Ca(+2) released-activated Ca(+2) (CRAC) channels in T-cells. This gene is thought to play an important role in calcium homeostasis. The gene is expressed from two promoters and undergoes extensive alternative splicing. The encoded set of proteins share varying amounts of overlap near their N-termini but have substantial variations in their C-terminal domains resulting in distinct functional properties. The longest isoforms (a and f) include a C-terminal Aspartyl/Asparaginyl beta-hydroxylase domain that hydroxylates aspartic acid or asparagine residues in the epidermal growth factor (EGF)-like domains of some proteins, including protein C, coagulation factors VII, IX, and X, and the complement facto ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000356457
  • ENSP00000348841
  • ENSG00000198363
  • ENST00000379449
  • ENSP00000368762
  • ENST00000379454
  • ENSP00000368767
  • ENST00000389204
  • ENSP00000373856
  • ENST00000445642
  • ENSP00000394013
  • ENST00000517847
  • ENSP00000429954
  • ENST00000517903
  • ENSP00000430245
  • ENST00000518068
  • ENSP00000429286
  • ENST00000522603
  • ENSP00000436188
  • ENST00000522835
  • ENSP00000429160
  • ENST00000541428
  • ENSP00000437864

Symbol
  • BAH
  • AAH
  • BAH
  • HAAH
  • JCTN
  • FDLAB
  • junctin
  • CASQ2BP1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
1
interacting protein
0.99
kinase perturbation
0.95
small molecule perturbation
0.88
transcription factor binding site profile
0.88


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 539.42   (req: < 5)
Gene RIFs: 24   (req: <= 3)
Antibodies: 300   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 539.42   (req: >= 5)
Gene RIFs: 24   (req: > 3)
Antibodies: 300   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 33
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (8)
1 – 5 of 8
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (8)
Cardiac conduction (R-HSA-5576891)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cardiac conduction
Reactome
Ion channel transport
Reactome
Ion homeostasis
Reactome
Muscle contraction
Reactome
Stimuli-sensing channels
Name
Explore in Pharos
Explore in Source
Cardiac conduction
Ion channel transport
Ion homeostasis
Muscle contraction
Stimuli-sensing channels
Gene Ontology Terms (44)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Traceable Author Statement (TAS)
UniProtKB
Traceable Author Statement (TAS)
BHF-UCL
Traceable Author Statement (TAS)
ProtInc
Traceable Author Statement (TAS)
ProtInc
Traceable Author Statement (TAS)
ProtInc
Protein-Protein Interactions (90)
1 – 10 of 90
MCUB
Tbio
Novelty: 0.11111111
p_int: 0.999999732
p_ni: 2.68e-7
Data Source: BioPlex
MCU
Tbio
Family: IC
Novelty: 0.00168833
p_int: 0.999997105
p_ni: 0.000002895
Score: 0.271
Data Source: BioPlex,STRINGDB
STEAP3
Tbio
Family: Enzyme
Novelty: 0.0328697
p_int: 0.999963683
p_ni: 0.000036317
Score: 0.157
Data Source: BioPlex,STRINGDB
FAM162A
Tbio
Novelty: 0.06219468
p_int: 0.99963524
p_ni: 0.00036476
Score: 0.167
Data Source: BioPlex,STRINGDB
TMEM160
Tdark
Novelty: 2.41414886
p_int: 0.998861186
p_ni: 0.001138814
Data Source: BioPlex
STX4
Tbio
Novelty: 0.01072491
p_int: 0.997141552
p_ni: 0.00285842
p_wrong: 2.8e-8
Score: 0.161
Data Source: BioPlex,STRINGDB
FBLN7
Tbio
Novelty: 0.04880033
p_int: 0.996563237
p_ni: 0.003436763
Score: 0.222
Data Source: BioPlex,STRINGDB
SMDT1
Tbio
Novelty: 0.02130362
p_int: 0.9959214
p_ni: 0.000507468
p_wrong: 0.003571132
Score: 0.175
Data Source: BioPlex,STRINGDB
NDUFAF1
Tclin
Novelty: 0.0776632
p_int: 0.995682131
p_ni: 0.004317869
Data Source: BioPlex
WDYHV1
Tdark
Family: Enzyme
Novelty: 0.23412216
p_int: 0.993208811
p_ni: 0.006791189
Data Source: BioPlex
Publication Statistics
PubMed Score  539.42

PubMed score by year
PubTator Score  187.6

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAQRKNAKSSGNSSSSGSGSGSTSAGSSSPGARRETKHGGHKNGRKGGLSGTSFFTWFMVIALLGVWTSV
1-70
AVVWFDLVDYEEVLGKLGIYDADGDGDFDVDDAKVLLGLKERSTSEPAVPPEEAEPHTEPEEQVPVEAEP
70-140
QNIEDEAKEQIQSLLHEMVHAEHVEGEDLQQEDGPTGEPQQEDDEFLMATDVDDRFETLEPEVSHEETEH
140-210
SYHVEETVSQDCNQDMEEMMSEQENPDSSEPVVEDERLHHDTDDVTYQVYEEQAVYEPLENEGIEITEVT
210-280
APPEDNPVEDSQVIVEEVSIFPVEEQQEVPPETNRKTDDPEQKAKVKKKKPKLLNKFDKTIKAELDAAEK
280-350
LRKRGKIEEAVNAFKELVRKYPQSPRARYGKAQCEDDLAEKRRSNEVLRGAIETYQEVASLPDVPADLLK
350-420
LSLKRRSDRQQFLGHMRGSLLTLQRLVQLFPNDTSLKNDLGVGYLLIGDNDNAKKVYEEVLSVTPNDGFA
420-490
KVHYGFILKAQNKIAESIPYLKEGIESGDPGTDDGRFYFHLGDAMQRVGNKEAYKWYELGHKRGHFASVW
490-560
QRSLYNVNGLKAQPWWTPKETGYTELVKSLERNWKLIRDEGLAVMDKAKGLFLPEDENLREKGDWSQFTL
560-630
WQQGRRNENACKGAPKTCTLLEKFPETTGCRRGQIKYSIMHPGTHVWPHTGPTNCRLRMHLGLVIPKEGC
630-700
KIRCANETKTWEEGKVLIFDDSFEHEVWQDASSFRLIFIVDVWHPELTPQQRRSLPAI
700-758
MAQRKNAKSSGNSSSSGSGSGSTSAGSSSPGARRETKHGGHKNGRKGGLSGTSFFTWFMVIALLGVWTSVAVVWFDLVDYEEVLGKLGIYDADGDGDFDVDDAKVLLGLKERSTSEPAVPPEEAEPHTEPEEQVPVEAEPQNIEDEAKEQIQSLLHEMVHAEHVEGEDLQQEDGPTGEPQQEDDEFLMATDVDDRFETLEPEVSHEETEHSYHVEETVSQDCNQDMEEMMSEQENPDSSEPVVEDERLHHDTDDVTYQVYEEQAVYEPLENEGIEITEVTAPPEDNPVEDSQVIVEEVSIFPVEEQQEVPPETNRKTDDPEQKAKVKKKKPKLLNKFDKTIKAELDAAEKLRKRGKIEEAVNAFKELVRKYPQSPRARYGKAQCEDDLAEKRRSNEVLRGAIETYQEVASLPDVPADLLKLSLKRRSDRQQFLGHMRGSLLTLQRLVQLFPNDTSLKNDLGVGYLLIGDNDNAKKVYEEVLSVTPNDGFAKVHYGFILKAQNKIAESIPYLKEGIESGDPGTDDGRFYFHLGDAMQRVGNKEAYKWYELGHKRGHFASVWQRSLYNVNGLKAQPWWTPKETGYTELVKSLERNWKLIRDEGLAVMDKAKGLFLPEDENLREKGDWSQFTLWQQGRRNENACKGAPKTCTLLEKFPETTGCRRGQIKYSIMHPGTHVWPHTGPTNCRLRMHLGLVIPKEGCKIRCANETKTWEEGKVLIFDDSFEHEVWQDASSFRLIFIVDVWHPELTPQQRRSLPAI