You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CTXN3
Cortexin-3

Protein Summary
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000379445
  • ENSP00000368758
  • ENSG00000205279
  • ENST00000395322
  • ENSP00000378732
  • ENST00000620385
  • ENSP00000482081

Symbol
  • KABE
  • KABE
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.96
cell line
0.56
PubMedID
0.55
transcription factor
0.48
disease
0.4


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 17.07   (req: < 5)
Gene RIFs: 4   (req: <= 3)
Antibodies: 0   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 17.07   (req: >= 5)
Gene RIFs: 4   (req: > 3)
Antibodies: 0   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (1)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (49)
1 – 10 of 49
RSRC1
Tbio
Novelty: 0.19164956
Score: 0.725
Data Source: STRINGDB
WWC1
Tbio
Novelty: 0.01018919
Score: 0.701
Data Source: STRINGDB
PTPN5
Tchem
Family: Enzyme
Novelty: 0.008679
Score: 0.629
Data Source: STRINGDB
CEP112
Tdark
Novelty: 0.54545455
Score: 0.583
Data Source: STRINGDB
RFXANK
Tbio
Novelty: 0.00130057
Score: 0.575
Data Source: STRINGDB
MINAR2
Tdark
Score: 0.554
Data Source: STRINGDB
NEUROD6
Tbio
Family: TF
Novelty: 0.02794951
Score: 0.537
Data Source: STRINGDB
HTR5A
Tchem
Family: GPCR
Novelty: 0.01826019
Score: 0.533
Data Source: STRINGDB
PRSS22
Tdark
Family: Enzyme
Novelty: 0.32419915
Score: 0.512
Data Source: STRINGDB
ARHGAP18
Tbio
Family: Enzyme
Novelty: 0.01270046
Score: 0.509
Data Source: STRINGDB
Publication Statistics
PubMed Score  17.07

PubMed score by year
PubTator Score  7.14

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDGGQPIPSSLVPLGNESADSSMSLEQKMTFVFVILLFIFLGILIVRCFRILLDPYRSMPTSTWADGLEG
1-70
LEKGQFDHALA
70-81
MDGGQPIPSSLVPLGNESADSSMSLEQKMTFVFVILLFIFLGILIVRCFRILLDPYRSMPTSTWADGLEGLEKGQFDHALA