You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
TNFRSF4
Tumor necrosis factor receptor superfamily member 4

Protein Summary
Description
Receptor for TNFSF4/OX40L/GP34. Is a costimulatory molecule implicated in long-term T-cell immunity. (Microbial infection) Acts as a receptor for human herpesvirus 6B/HHV-6B. The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been shown to activate NF-kappaB through its interaction with adaptor proteins TRAF2 and TRAF5. Knockout studies in mice suggested that this receptor promotes the expression of apoptosis inhibitors BCL2 and BCL2lL1/BCL2-XL, and thus suppresses apoptosis. The knockout studies also suggested the roles of this receptor in CD4+ T cell response, as well as in T cell-dependent B cell proliferation and differentiation. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000379236
  • ENSP00000368538
  • ENSG00000186827

Symbol
  • TXGP1L
  • OX40
  • ACT35
  • CD134
  • IMD16
  • TXGP1L
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
0.99
biological process
0.89
biological term
0.73
cell type or tissue
0.69
gene perturbation
0.62


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 458.87   (req: < 5)
Gene RIFs: 77   (req: <= 3)
Antibodies: 773   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 458.87   (req: >= 5)
Gene RIFs: 77   (req: > 3)
Antibodies: 773   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 15
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 1
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (6)
Cytokine Signaling in Immune system (R-HSA-1280215)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytokine Signaling in Immune system
Reactome
Immune System
Reactome
TNFR2 non-canonical NF-kB pathway
Reactome
TNFs bind their physiological receptors
Name
Explore in Pharos
Explore in Source
Cytokine Signaling in Immune system
Immune System
TNFR2 non-canonical NF-kB pathway
TNFs bind their physiological receptors
Protein-Protein Interactions (140)
1 – 10 of 140
TNFSF4
Tbio
Novelty: 0.00378283
Score: 0.999
Data Source: Reactome,STRINGDB
CTLA4
Tclin
Novelty: 0.00017405
Score: 0.907
Data Source: STRINGDB
CD28
Tbio
Novelty: 0.00051946
Score: 0.876
Data Source: STRINGDB
TNFRSF18
Tbio
Novelty: 0.00518763
Score: 0.857
Data Source: STRINGDB
IL2
Tchem
Novelty: 0.00004362
Score: 0.845
Data Source: STRINGDB
TNF
Tclin
Novelty: 0.00001974
Score: 0.831
Data Source: STRINGDB
FOXP3
Tbio
Family: TF
Novelty: 0.00020363
Score: 0.827
Data Source: STRINGDB
IL4
Tbio
Novelty: 0.00010156
Score: 0.794
Data Source: STRINGDB
TRAF5
Tbio
Novelty: 0.01881484
Score: 0.785
Data Source: STRINGDB
TRAF3
Tbio
Novelty: 0.00292884
Score: 0.781
Data Source: STRINGDB
Publication Statistics
PubMed Score  458.87

PubMed score by year
PubTator Score  228.6

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MCVGARRLGRGPCAALLLLGLGLSTVTGLHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPG
1-70
FYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQA
70-140
CKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVP
140-210
GGRAVAAILGLGLVLGLLGPLAILLALYLLRRDQRLPPDAHKPPGGGSFRTPIQEEQADAHSTLAKI
210-277
MCVGARRLGRGPCAALLLLGLGLSTVTGLHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVAAILGLGLVLGLLGPLAILLALYLLRRDQRLPPDAHKPPGGGSFRTPIQEEQADAHSTLAKI