You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ARX
Homeobox protein ARX

Protein Summary
Description
Transcription factor required for normal brain development. May be important for maintenance of specific neuronal subtypes in the cerebral cortex and axonal guidance in the floor plate. This gene is a homeobox-containing gene expressed during development. The expressed protein contains two conserved domains, a C-peptide (or aristaless domain) and the prd-like class homeobox domain. It is a member of the group-II aristaless-related protein family whose members are expressed primarily in the central and/or peripheral nervous system. This gene is thought to be involved in CNS development. Expansion of a polyalanine tract and other mutations in this gene cause X-linked cognitive disability and epilepsy. [provided by RefSeq, Jul 2016]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000379044
  • ENSP00000368332
  • ENSG00000004848

Symbol
  • ISSX
  • PRTS
  • CT121
  • EIEE1
  • MRX29
  • MRX32
  • MRX33
  • MRX36
  • MRX38
  • MRX43
  • MRX54
  • MRX76
  • MRX87
  • MRXS1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
phenotype
0.86
molecular function
0.81
biological process
0.78
biological term
0.66
cell type or tissue
0.6


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 170.62   (req: < 5)
Gene RIFs: 70   (req: <= 3)
Antibodies: 368   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 170.62   (req: >= 5)
Gene RIFs: 70   (req: > 3)
Antibodies: 368   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 15
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (16)
Items per page:
10
1 – 4 of 4
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
MGI
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (57)
1 – 10 of 57
TLX2
Tbio
Family: TF
Novelty: 0.00626288
Score: 0.789
Data Source: STRINGDB
TLX3
Tbio
Family: TF
Novelty: 0.0183218
Score: 0.787
Data Source: STRINGDB
TLX1
Tbio
Family: TF
Novelty: 0.00747236
Score: 0.751
Data Source: STRINGDB
PCDH19
Tbio
Novelty: 0.01768583
Score: 0.729
Data Source: STRINGDB
IL1RAPL1
Tbio
Novelty: 0.01729512
Score: 0.664
Data Source: STRINGDB
CLCN4
Tchem
Family: IC
Novelty: 0.02515392
Score: 0.657
Data Source: STRINGDB
STXBP1
Tbio
Novelty: 0.00423336
Score: 0.655
Data Source: STRINGDB
PNKP
Tbio
Family: Enzyme
Novelty: 0.01442297
Score: 0.649
Data Source: STRINGDB
TUBA1A
Tchem
Novelty: 0.0159455
Score: 0.647
Data Source: STRINGDB
IPO13
Tbio
Novelty: 0.01634473
Score: 0.646
Data Source: STRINGDB
Publication Statistics
PubMed Score  170.62

PubMed score by year
PubTator Score  300.07

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSNQYQEEGCSERPECKSKSPTLLSSYCIDSILGRRSPCKMRLLGAAQSLPAPLTSRADPEKAVQGSPKS
1-70
SSAPFEAELHLPPKLRRLYGPGGGRLLQGAAAAAAAAAAAAAAAATATAGPRGEAPPPPPPTARPGERPD
70-140
GAGAAAAAAAAAAAAWDTLKISQAPQVSISRSKSYRENGAPFVPPPPALDELGGPGGVTHPEERLGVAGG
140-210
PGSAPAAGGGTGTEDDEEELLEDEEDEDEEEELLEDDEEELLEDDARALLKEPRRCPVAATGAVAAAAAA
210-280
AVATEGGELSPKEELLLHPEDAEGKDGEDSVCLSAGSDSEEGLLKRKQRRYRTTFTSYQLEELERAFQKT
280-350
HYPDVFTREELAMRLDLTEARVQVWFQNRRAKWRKREKAGAQTHPPGLPFPGPLSATHPLSPYLDASPFP
350-420
PHHPALDSAWTAAAAAAAAAFPSLPPPPGSASLPPSGAPLGLSTFLGAAVFRHPAFISPAFGRLFSTMAP
420-490
LTSASTAAALLRQPTPAVEGAVASGALADPATAAADRRASSIAALRLKAKEHAAQLTQLNILPGTSTGKE
490-560
VC
560-562
MSNQYQEEGCSERPECKSKSPTLLSSYCIDSILGRRSPCKMRLLGAAQSLPAPLTSRADPEKAVQGSPKSSSAPFEAELHLPPKLRRLYGPGGGRLLQGAAAAAAAAAAAAAAAATATAGPRGEAPPPPPPTARPGERPDGAGAAAAAAAAAAAAWDTLKISQAPQVSISRSKSYRENGAPFVPPPPALDELGGPGGVTHPEERLGVAGGPGSAPAAGGGTGTEDDEEELLEDEEDEDEEEELLEDDEEELLEDDARALLKEPRRCPVAATGAVAAAAAAAVATEGGELSPKEELLLHPEDAEGKDGEDSVCLSAGSDSEEGLLKRKQRRYRTTFTSYQLEELERAFQKTHYPDVFTREELAMRLDLTEARVQVWFQNRRAKWRKREKAGAQTHPPGLPFPGPLSATHPLSPYLDASPFPPHHPALDSAWTAAAAAAAAAFPSLPPPPGSASLPPSGAPLGLSTFLGAAVFRHPAFISPAFGRLFSTMAPLTSASTAAALLRQPTPAVEGAVASGALADPATAAADRRASSIAALRLKAKEHAAQLTQLNILPGTSTGKEVC