You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
BMP2
Bone morphogenetic protein 2

Protein Summary
Description
Induces cartilage and bone formation (PubMed:3201241). Stimulates the differentiation of myoblasts into osteoblasts via the EIF2AK3-EIF2A- ATF4 pathway. BMP2 activation of EIF2AK3 stimulates phosphorylation of EIF2A which leads to increased expression of ATF4 which plays a central role in osteoblast differentiation. In addition stimulates TMEM119, which upregulates the expression of ATF4 (PubMed:24362451). This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer, which plays a role in bone and cartilage development. Duplication of a regulatory region downstream of this gene causes a form of brachydactyly characterized by a malformed index finger and second toe in ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000378827
  • ENSP00000368104
  • ENSG00000125845

Symbol
  • BMP2A
  • BDA2
  • BMP2A
  • SSFSC
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
biological term
1
gene perturbation
1
PubMedID
0.94
protein domain
0.85


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5162.01   (req: < 5)
Gene RIFs: 498   (req: <= 3)
Antibodies: 887   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5162.01   (req: >= 5)
Gene RIFs: 498   (req: > 3)
Antibodies: 887   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 98
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (18)
1 – 5 of 18
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (38)
Elastic fibre formation (R-HSA-1566948)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 11
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Elastic fibre formation
Reactome
Extracellular matrix organization
Reactome
Gene expression (Transcription)
Reactome
Generic Transcription Pathway
Reactome
Molecules associated with elastic fibres
Name
Explore in Pharos
Explore in Source
Elastic fibre formation
Extracellular matrix organization
Gene expression (Transcription)
Generic Transcription Pathway
Molecules associated with elastic fibres
Gene Ontology Terms (103)
Items per page:
10
1 – 10 of 10
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
MGI
Inferred from Direct Assay (IDA)
MGI
Inferred from Direct Assay (IDA)
MGI
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (362)
1 – 10 of 362
BMPR1A
Tchem
Family: Kinase
Novelty: 0.00472897
Score: 0.999
Data Source: Reactome,STRINGDB
ACVR2B
Tchem
Family: Kinase
Novelty: 0.00693595
Score: 0.999
Data Source: Reactome,STRINGDB
CHRD
Tbio
Novelty: 0.00426792
Score: 0.998
Data Source: STRINGDB
RGMB
Tbio
Novelty: 0.00152793
Score: 0.998
Data Source: STRINGDB
RGMA
Tbio
Novelty: 0.0034752
Score: 0.997
Data Source: STRINGDB
ACVR2A
Tchem
Family: Kinase
Novelty: 0.007745
Score: 0.996
Data Source: Reactome,STRINGDB
NOG
Tbio
Novelty: 0.00131071
Score: 0.995
Data Source: STRINGDB
HJV
Tbio
Novelty: 0.00627463
Score: 0.995
Data Source: STRINGDB
BMPR1B
Tchem
Family: Kinase
Novelty: 0.00996192
Score: 0.995
Data Source: Reactome,STRINGDB
BMPR2
Tchem
Family: Kinase
Novelty: 0.00191079
Score: 0.993
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  5162.01

PubMed score by year
PubTator Score  3017.46

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MVAGTRCLLALLLPQVLLGGAAGLVPELGRRKFAAASSGRPSSQPSDEVLSEFELRLLSMFGLKQRPTPS
1-70
RDAVVPPYMLDLYRRHSGQPGSPAPDHRLERAASRANTVRSFHHEESLEELPETSGKTTRRFFFNLSSIP
70-140
TEEFITSAELQVFREQMQDALGNNSSFHHRINIYEIIKPATANSKFPVTRLLDTRLVNQNASRWESFDVT
140-210
PAVMRWTAQGHANHGFVVEVAHLEEKQGVSKRHVRISRSLHQDEHSWSQIRPLLVTFGHDGKGHPLHKRE
210-280
KRQAKHKQRKRLKSSCKRHPLYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVN
280-350
SVNSKIPKACCVPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR
350-396
MVAGTRCLLALLLPQVLLGGAAGLVPELGRRKFAAASSGRPSSQPSDEVLSEFELRLLSMFGLKQRPTPSRDAVVPPYMLDLYRRHSGQPGSPAPDHRLERAASRANTVRSFHHEESLEELPETSGKTTRRFFFNLSSIPTEEFITSAELQVFREQMQDALGNNSSFHHRINIYEIIKPATANSKFPVTRLLDTRLVNQNASRWESFDVTPAVMRWTAQGHANHGFVVEVAHLEEKQGVSKRHVRISRSLHQDEHSWSQIRPLLVTFGHDGKGHPLHKREKRQAKHKQRKRLKSSCKRHPLYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNSVNSKIPKACCVPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR