You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
PRKCZ
Protein kinase C zeta type

Protein Classes
Protein Summary
Description
Calcium- and diacylglycerol-independent serine/threonine-protein kinase that functions in phosphatidylinositol 3-kinase (PI3K) pathway and mitogen-activated protein (MAP) kinase cascade, and is involved in NF-kappa-B activation, mitogenic signaling, cell proliferation, cell polarity, inflammatory response and maintenance of long-term potentiation (LTP). Upon lipopolysaccharide (LPS) treatment in macrophages, or following mitogenic stimuli, functions downstream of PI3K to activate MAP2K1/MEK1-MAPK1/ERK2 signaling cascade independently of RAF1 activation. Required for insulin-dependent activation of AKT3, but may function as an adapter rather than a direct activator. Upon insulin treatment may act as a downstream effector of PI3K and contribute to the activation of translocation of the glucose transporter SLC2A4/GLUT4 and subsequent glucose transport in adipocytes. In EGF-induced cells, binds and activates MAP2K5/MEK5-MAPK7/ERK5 independently of its kinase activity and can activate JUN p ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000378567
  • ENSP00000367830
  • ENSG00000067606
  • ENST00000400921
  • ENSP00000383712
  • ENST00000461106
  • ENSP00000426412

Symbol
  • PKC2
  • PKC2
  • PKC-ZETA
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
hub protein
1
protein domain
1
molecular function
0.99
biological term
0.98


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 377.96   (req: < 5)
Gene RIFs: 166   (req: <= 3)
Antibodies: 774   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 377.96   (req: >= 5)
Gene RIFs: 166   (req: > 3)
Antibodies: 774   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 50
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 15
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (100)
ESR-mediated signaling (R-HSA-8939211)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 18
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
ESR-mediated signaling
Reactome
Estrogen-stimulated signaling through PRKCZ
Reactome
Extra-nuclear estrogen signaling
Reactome
GPVI-mediated activation cascade
Reactome
Hemostasis
Name
Explore in Pharos
Explore in Source
ESR-mediated signaling
Estrogen-stimulated signaling through PRKCZ
Extra-nuclear estrogen signaling
GPVI-mediated activation cascade
Hemostasis
Gene Ontology Terms (75)
Items per page:
10
1 – 10 of 11
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
BHF-UCL
Traceable Author Statement (TAS)
Reactome
Inferred by Curator (IC)
BHF-UCL
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (259)
1 – 10 of 259
PARD6B
Tbio
Novelty: 0.11958639
p_int: 1
Score: 0.995
Data Source: BioPlex,STRINGDB
LLGL2
Tbio
Novelty: 0.10375119
p_int: 0.999999997
p_ni: 3e-9
Score: 0.86
Data Source: BioPlex,STRINGDB
PRKCI
Tchem
Family: Kinase
Novelty: 0.01104604
p_int: 0.999997945
p_ni: 0.000002055
Score: 0.975
Data Source: BioPlex,STRINGDB
PARD6G
Tbio
Novelty: 0.41088581
p_int: 0.999656778
p_ni: 1.3e-8
p_wrong: 0.000343209
Score: 0.996
Data Source: BioPlex,STRINGDB
LLGL1
Tbio
Novelty: 0.00921679
p_int: 0.999421931
p_ni: 0.000578069
Score: 0.922
Data Source: BioPlex,STRINGDB
TRIM41
Tbio
Family: Enzyme
Novelty: 0.19066576
p_int: 0.999245634
p_ni: 0.000754365
p_wrong: 1e-9
Score: 0.329
Data Source: BioPlex,STRINGDB
WWC1
Tbio
Novelty: 0.01018919
p_int: 0.997932395
p_ni: 0.000026397
p_wrong: 0.002041208
Score: 0.979
Data Source: BioPlex,STRINGDB
NIPSNAP2
Tbio
Novelty: 0.0616559
p_int: 0.990044862
p_ni: 0.009955138
Score: 0.219
Data Source: BioPlex,STRINGDB
CDC42BPB
Tbio
Family: Kinase
Novelty: 0.23112171
p_int: 0.986977157
p_ni: 0.013022843
Score: 0.21
Data Source: BioPlex,STRINGDB
SQSTM1
Tbio
Novelty: 0.0013045
p_int: 0.971148548
p_ni: 0.028851452
Score: 0.955
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  377.96

PubMed score by year
PubTator Score  353.4

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MPSRTGPKMEGSGGRVRLKAHYGGDIFITSVDAATTFEELCEEVRDMCRLHQQHPLTLKWVDSEGDPCTV
1-70
SSQMELEEAFRLARQCRDEGLIIHVFPSTPEQPGLPCPGEDKSIYRRGARRWRKLYRANGHLFQAKRFNR
70-140
RAYCGQCSERIWGLARQGYRCINCKLLVHKRCHGLVPLTCRKHMDSVMPSQEPPVDDKNEDADLPSEETD
140-210
GIAYISSSRKHDSIKDDSEDLKPVIDGMDGIKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAM
210-280
KVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPE
280-350
EHARFYAAEICIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAP
350-420
EILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRFLSVKASHVLK
420-490
GFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQALPPFQPQITDDYGLDNFDTQFTSEPVQLT
490-560
PDDEDAIKRIDQSEFEGFEYINPLLLSTEESV
560-592
MPSRTGPKMEGSGGRVRLKAHYGGDIFITSVDAATTFEELCEEVRDMCRLHQQHPLTLKWVDSEGDPCTVSSQMELEEAFRLARQCRDEGLIIHVFPSTPEQPGLPCPGEDKSIYRRGARRWRKLYRANGHLFQAKRFNRRAYCGQCSERIWGLARQGYRCINCKLLVHKRCHGLVPLTCRKHMDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKPVIDGMDGIKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRFLSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQALPPFQPQITDDYGLDNFDTQFTSEPVQLTPDDEDAIKRIDQSEFEGFEYINPLLLSTEESV