You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
REEP2
Receptor expression-enhancing protein 2

Protein Classes
Protein Summary
Description
Required for endoplasmic reticulum (ER) network formation, shaping and remodeling. May enhance the cell surface expression of odorant receptors (By similarity). This gene encodes a member of the receptor expression enhancing protein family. Studies of a related gene in mouse suggest that the encoded protein is found in the cell membrane and enhances the function of sweet taste receptors. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2012]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000254901
  • ENSP00000254901
  • ENSG00000132563
  • ENST00000378339
  • ENSP00000367590

Symbol
  • C5orf19
  • SGC32445
  • SPG72
  • Yip2d
  • C5orf19
  • SGC32445
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.81
cellular component
0.77
gene perturbation
0.63
tissue sample
0.58
phenotype
0.52


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3.32   (req: < 5)
Gene RIFs: 3   (req: <= 3)
Antibodies: 330   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3.32   (req: >= 5)
Gene RIFs: 3   (req: > 3)
Antibodies: 330   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (5)
G alpha (s) signalling events (R-HSA-418555)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
G alpha (s) signalling events
Reactome
GPCR downstream signalling
Reactome
Olfactory Signaling Pathway
Reactome
Signal Transduction
Reactome
Signaling by GPCR
Name
Explore in Pharos
Explore in Source
G alpha (s) signalling events
GPCR downstream signalling
Olfactory Signaling Pathway
Signal Transduction
Signaling by GPCR
Gene Ontology Terms (10)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (420)
1 – 10 of 420
CAV3
Tbio
Novelty: 0.00250765
p_int: 0.98831547
p_ni: 2.37e-7
p_wrong: 0.011684293
Score: 0.663
Data Source: BioPlex,STRINGDB
KCNIP2
Tbio
Family: IC
Novelty: 0.0124069
p_int: 0.98197092
p_ni: 0.017939641
p_wrong: 0.000089439
Score: 0.375
Data Source: BioPlex,STRINGDB
REEP1
Tbio
Novelty: 0.02999447
p_int: 0.885992478
p_ni: 2.37e-7
p_wrong: 0.114007286
Score: 0.842
Data Source: BioPlex,STRINGDB
ATP5PF
Tbio
Family: Enzyme
Novelty: 0.00355338
p_int: 0.765705926
p_ni: 0.000005348
p_wrong: 0.234288726
Data Source: BioPlex
DSG4
Tbio
Novelty: 0.00431663
p_int: 0.76473533
p_ni: 0.227292031
p_wrong: 0.00797264
Score: 0.173
Data Source: BioPlex,STRINGDB
GNAL
Tbio
Novelty: 0.0277957
Score: 0.905
Data Source: STRINGDB
OR13G1
Tdark
Family: oGPCR
Novelty: 1.0619469
Score: 0.905
Data Source: STRINGDB
OR1L8
Tdark
Family: oGPCR
Score: 0.905
Data Source: STRINGDB
OR5J2
Tdark
Family: oGPCR
Novelty: 5
Score: 0.904
Data Source: STRINGDB
OR14I1
Tdark
Family: oGPCR
Novelty: 1
Score: 0.903
Data Source: STRINGDB
Publication Statistics
PubMed Score  3.32

PubMed score by year
PubTator Score  4.19

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MVSWIISRLVVLIFGTLYPAYSSYKAVKTKNVKEYVKWMMYWIVFAFFTTAETLTDIVLSWFPFYFELKI
1-70
AFVIWLLSPYTKGSSVLYRKFVHPTLSNKEKEIDEYITQARDKSYETMMRVGKRGLNLAANAAVTAAAKG
70-140
VLSEKLRSFSMQDLTLIRDEDALPLQRPDGRLRPSPGSLLDTIEDLGDDPALSLRSSTNPADSRTEASED
140-210
DMGDKAPKRAKPIKKAPKAEPLASKTLKTRPKKKTSGGGDSA
210-252
MVSWIISRLVVLIFGTLYPAYSSYKAVKTKNVKEYVKWMMYWIVFAFFTTAETLTDIVLSWFPFYFELKIAFVIWLLSPYTKGSSVLYRKFVHPTLSNKEKEIDEYITQARDKSYETMMRVGKRGLNLAANAAVTAAAKGVLSEKLRSFSMQDLTLIRDEDALPLQRPDGRLRPSPGSLLDTIEDLGDDPALSLRSSTNPADSRTEASEDDMGDKAPKRAKPIKKAPKAEPLASKTLKTRPKKKTSGGGDSA