You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
NDUFAF5
Arginine-hydroxylase NDUFAF5, mitochondrial

Protein Summary
Description
Arginine hydroxylase involved in the assembly of mitochondrial NADH:ubiquinone oxidoreductase complex (complex I, MT-ND1) at early stages (PubMed:18940309, PubMed:27226634). Acts by mediating hydroxylation of 'Arg-111' of NDUFS7 (PubMed:27226634). May also have methyltransferase activity (Probable). The NADH-ubiquinone oxidoreductase complex (complex I) of the mitochondrial respiratory chain catalyzes the transfer of electrons from NADH to ubiquinone, and consists of at least 43 subunits. The complex is located in the inner mitochondrial membrane. This gene encodes a mitochondrial protein that is associated with the matrix face of the mitochondrial inner membrane and is required for complex I assembly. A mutation in this gene results in mitochondrial complex I deficiency. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2009]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000378106
  • ENSP00000367346
  • ENSG00000101247
  • ENST00000463598
  • ENSP00000420497

Symbol
  • C20orf7
  • C20orf7
  • MC1DN16
  • dJ842G6.1
  • bA526K24.2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.82
cell type or tissue
0.74
transcription factor binding site profile
0.69
cellular component
0.65
cell line
0.61


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5.9   (req: < 5)
Gene RIFs: 5   (req: <= 3)
Antibodies: 107   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5.9   (req: >= 5)
Gene RIFs: 5   (req: > 3)
Antibodies: 107   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (6)
Complex I biogenesis (R-HSA-6799198)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Complex I biogenesis
Reactome
Metabolism
Reactome
Respiratory electron transport
Reactome
Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins.
Reactome
The citric acid (TCA) cycle and respiratory electron transport
Name
Explore in Pharos
Explore in Source
Complex I biogenesis
Metabolism
Respiratory electron transport
Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins.
The citric acid (TCA) cycle and respiratory electron transport
Gene Ontology Terms (7)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (129)
1 – 10 of 129
XRCC2
Tbio
Novelty: 0.00954601
p_int: 0.99995788
p_ni: 0.00002701
p_wrong: 0.00001511
Score: 0.735
Data Source: BioPlex,STRINGDB
NDUFAF8
Tbio
Novelty: 2
p_int: 0.999912316
p_ni: 0.000087684
p_wrong: 1e-9
Score: 0.236
Data Source: BioPlex,STRINGDB
NDUFS7
Tclin
Family: Enzyme
Novelty: 0.00101318
p_int: 0.999586419
p_ni: 0.00041358
Score: 0.996
Data Source: BioPlex,STRINGDB
HBB
Tbio
Novelty: 0.00039916
p_int: 0.999363987
p_ni: 0.000636013
Data Source: BioPlex
MRPL38
Tdark
Novelty: 0.83832335
p_int: 0.998005838
p_ni: 0.001994161
p_wrong: 1e-9
Score: 0.174
Data Source: BioPlex,STRINGDB
LNP1
Tdark
Novelty: 0.00958233
p_int: 0.997554476
p_ni: 0.002445518
p_wrong: 7e-9
Data Source: BioPlex
NDUFAF4
Tclin
Family: Enzyme
Novelty: 0.18993352
p_int: 0.997052394
p_ni: 0.002947535
p_wrong: 7.1e-8
Score: 0.981
Data Source: BioPlex,Reactome,STRINGDB
NPPB
Tbio
Novelty: 0.00039465
p_int: 0.996831997
p_ni: 0.003167996
p_wrong: 6e-9
Data Source: BioPlex
KLHL22
Tbio
Novelty: 0.50704225
p_int: 0.996485425
p_ni: 0.00351448
p_wrong: 9.5e-8
Data Source: BioPlex
NPPA
Tchem
Novelty: 0.00054421
p_int: 0.995100116
p_ni: 0.00489985
p_wrong: 3.4e-8
Data Source: BioPlex
Publication Statistics
PubMed Score  5.90

PubMed score by year
PubTator Score  7.6

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MLRPAGLWRLCRRPWAARVPAENLGRREVTSGVSPRGSTSPRTLNIFDRDLKRKQKNWAARQPEPTKFDY
1-70
LKEEVGSRIADRVYDIPRNFPLALDLGCGRGYIAQYLNKETIGKFFQADIAENALKNSSETEIPTVSVLA
70-140
DEEFLPFKENTFDLVVSSLSLHWVNDLPRALEQIHYILKPDGVFIGAMFGGDTLYELRCSLQLAETEREG
140-210
GFSPHISPFTAVNDLGHLLGRAGFNTLTVDTDEIQVNYPGMFELMEDLQGMGESNCAWNRKALLHRDTML
210-280
AAAAVYREMYRNEDGSVPATYQIYYMIGWKYHESQARPAERGSATVSFGELGKINNLMPPGKKSQ
280-345
MLRPAGLWRLCRRPWAARVPAENLGRREVTSGVSPRGSTSPRTLNIFDRDLKRKQKNWAARQPEPTKFDYLKEEVGSRIADRVYDIPRNFPLALDLGCGRGYIAQYLNKETIGKFFQADIAENALKNSSETEIPTVSVLADEEFLPFKENTFDLVVSSLSLHWVNDLPRALEQIHYILKPDGVFIGAMFGGDTLYELRCSLQLAETEREGGFSPHISPFTAVNDLGHLLGRAGFNTLTVDTDEIQVNYPGMFELMEDLQGMGESNCAWNRKALLHRDTMLAAAAVYREMYRNEDGSVPATYQIYYMIGWKYHESQARPAERGSATVSFGELGKINNLMPPGKKSQ