You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PTER
Phosphotriesterase-related protein

Protein Classes
Protein Summary
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000298942
  • ENSP00000298942
  • ENSG00000165983
  • ENST00000378000
  • ENSP00000367239
  • ENST00000535784
  • ENSP00000439485

Symbol
  • HPHRP
  • RPR-1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.85
transcription factor perturbation
0.8
cell type or tissue
0.68
disease perturbation
0.68
virus perturbation
0.68


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 61.67   (req: < 5)
Gene RIFs: 5   (req: <= 3)
Antibodies: 95   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 61.67   (req: >= 5)
Gene RIFs: 5   (req: > 3)
Antibodies: 95   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (5)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
InterPro
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (84)
1 – 10 of 84
NPDC1
Tbio
Novelty: 0.0408998
p_int: 0.999890493
p_ni: 0.000109483
p_wrong: 2.4e-8
Score: 0.243
Data Source: BioPlex,STRINGDB
TEKT2
Tbio
Novelty: 0.05869619
p_int: 0.999859451
p_ni: 0.000140541
p_wrong: 8e-9
Score: 0.189
Data Source: BioPlex,STRINGDB
CDKN2D
Tbio
Family: Enzyme
Novelty: 0.02077911
p_int: 0.999633438
p_ni: 0.000366548
p_wrong: 1.4e-8
Data Source: BioPlex
KHDRBS2
Tbio
Novelty: 0.04072144
p_int: 0.998034605
p_ni: 0.001962663
p_wrong: 0.000002732
Score: 0.18
Data Source: BioPlex,STRINGDB
CARTPT
Tbio
Novelty: 0.00031238
p_int: 0.996266828
p_ni: 0.003677004
p_wrong: 0.000056168
Data Source: BioPlex
SNX3
Tbio
Novelty: 0.04222945
p_int: 0.99624948
p_ni: 0.002316472
p_wrong: 0.001434048
Data Source: BioPlex
HYAL3
Tbio
Family: Enzyme
Novelty: 0.19292605
p_int: 0.994960389
p_ni: 0.002319703
p_wrong: 0.002719909
Score: 0.252
Data Source: BioPlex,STRINGDB
TMEM51
Tdark
Novelty: 1.41176471
p_int: 0.99433841
p_ni: 0.005656611
p_wrong: 0.000004979
Score: 0.169
Data Source: BioPlex,STRINGDB
LIPH
Tbio
Family: Enzyme
Novelty: 0.01028878
p_int: 0.992618037
p_ni: 0.00264845
p_wrong: 0.004733514
Score: 0.185
Data Source: BioPlex,STRINGDB
DNAJB3
Tdark
p_int: 0.992540492
p_ni: 0.007415297
p_wrong: 0.000044211
Data Source: BioPlex
Publication Statistics
PubMed Score  61.67

PubMed score by year
PubTator Score  22.79

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSSLSGKVQTVLGLVEPSKLGRTLTHEHLAMTFDCCYCPPPPCQEAISKEPIVMKNLYWIQKNAYSHKEN
1-70
LQLNQETEAIKEELLYFKANGGGALVENTTTGISRDTQTLKRLAEETGVHIISGAGFYVDATHSSETRAM
70-140
SVEQLTDVLMNEILHGADGTSIKCGIIGEIGCSWPLTESERKVLQATAHAQAQLGCPVIIHPGRSSRAPF
140-210
QIIRILQEAGADISKTVMSHLDRTILDKKELLEFAQLGCYLEYDLFGTELLHYQLGPDIDMPDDNKRIRR
210-280
VRLLVEEGCEDRILVAHDIHTKTRLMKYGGHGYSHILTNVVPKMLLRGITENVLDKILIENPKQWLTFK
280-349
MSSLSGKVQTVLGLVEPSKLGRTLTHEHLAMTFDCCYCPPPPCQEAISKEPIVMKNLYWIQKNAYSHKENLQLNQETEAIKEELLYFKANGGGALVENTTTGISRDTQTLKRLAEETGVHIISGAGFYVDATHSSETRAMSVEQLTDVLMNEILHGADGTSIKCGIIGEIGCSWPLTESERKVLQATAHAQAQLGCPVIIHPGRSSRAPFQIIRILQEAGADISKTVMSHLDRTILDKKELLEFAQLGCYLEYDLFGTELLHYQLGPDIDMPDDNKRIRRVRLLVEEGCEDRILVAHDIHTKTRLMKYGGHGYSHILTNVVPKMLLRGITENVLDKILIENPKQWLTFK