You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
DPP6
Dipeptidyl aminopeptidase-like protein 6

Protein Summary
Description
Promotes cell surface expression of the potassium channel KCND2 (PubMed:15454437, PubMed:19441798). Modulates the activity and gating characteristics of the potassium channel KCND2 (PubMed:18364354). Has no dipeptidyl aminopeptidase activity (PubMed:8103397, PubMed:15476821). This gene encodes a single-pass type II membrane protein that is a member of the peptidase S9B family of serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties. Variations in this gene may be associated with susceptibility to amyotrophic lateral sclerosis and with idiopathic ventricular fibrillation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2014]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000332007
  • ENSP00000328226
  • ENSG00000130226
  • ENST00000377770
  • ENSP00000367001
  • ENST00000634466
  • ENSP00000488956
  • ENSG00000282974
  • ENST00000634541
  • ENSP00000489137

Symbol
  • VF2
  • DPL1
  • DPPX
  • MRD33
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
trait
1
transcription factor
0.74
PubMedID
0.66
disease
0.62
tissue
0.62


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 120.88   (req: < 5)
Gene RIFs: 34   (req: <= 3)
Antibodies: 214   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 120.88   (req: >= 5)
Gene RIFs: 34   (req: > 3)
Antibodies: 214   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Protein-Protein Interactions (115)
1 – 10 of 115
DNAAF2
Tbio
Novelty: 0.04657397
p_int: 0.999787652
p_ni: 7.87e-7
p_wrong: 0.000211561
Score: 0.165
Data Source: BioPlex,STRINGDB
CSGALNACT2
Tbio
Family: Enzyme
Novelty: 0.1003811
p_int: 0.999631913
p_ni: 0.000368085
p_wrong: 2e-9
Data Source: BioPlex
APOL2
Tbio
Novelty: 0.11533245
p_int: 0.983802268
p_ni: 0.01583508
p_wrong: 0.000362652
Data Source: BioPlex
ATP5MC1
Tbio
Family: Enzyme
Novelty: 0.05848632
p_int: 0.954127157
p_ni: 0.045695151
p_wrong: 0.000177692
Data Source: BioPlex
HAX1
Tbio
Novelty: 0.00851075
p_int: 0.929515254
p_ni: 0.000020319
p_wrong: 0.070464426
Data Source: BioPlex
NUDT9
Tbio
Family: Enzyme
Novelty: 0.03250355
p_int: 0.908112537
p_ni: 0.045411192
p_wrong: 0.046476271
Data Source: BioPlex
UXS1
Tbio
Family: Enzyme
Novelty: 0.0861244
p_int: 0.896870928
p_ni: 0.080329294
p_wrong: 0.022799777
Data Source: BioPlex
POMGNT2
Tbio
Family: Enzyme
Novelty: 0.13850541
p_int: 0.848550223
p_ni: 0.151449777
Data Source: BioPlex
LAMB1
Tbio
Novelty: 0.01303566
p_int: 0.757696024
p_ni: 0.242303976
Data Source: BioPlex
TNFSF9
Tbio
Novelty: 0.00636223
p_int: 0.755510167
p_ni: 0.244486593
p_wrong: 0.00000324
Data Source: BioPlex
Publication Statistics
PubMed Score  120.88

PubMed score by year
PubTator Score  86.27

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MASLYQRFTGKINTSRSFPAPPEASHLLGGQGPEEDGGAGAKPLGPRAQAAAPRERGGGGGGAGGRPRFQ
1-70
YQARSDGDEEDELVGSNPPQRNWKGIAIALLVILVICSLIVTSVILLTPAEDNSLSQKKKVTVEDLFSED
70-140
FKIHDPEAKWISDTEFIYREQKGTVRLWNVETNTSTVLIEGKKIESLRAIRYEISPDREYALFSYNVEPI
140-210
YQHSYTGYYVLSKIPHGDPQSLDPPEVSNAKLQYAGWGPKGQQLIFIFENNIYYCAHVGKQAIRVVSTGK
210-280
EGVIYNGLSDWLYEEEILKTHIAHWWSPDGTRLAYAAINDSRVPIMELPTYTGSIYPTVKPYHYPKAGSE
280-350
NPSISLHVIGLNGPTHDLEMMPPDDPRMREYYITMVKWATSTKVAVTWLNRAQNVSILTLCDATTGVCTK
350-420
KHEDESEAWLHRQNEEPVFSKDGRKFFFIRAIPQGGRGKFYHITVSSSQPNSSNDNIQSITSGDWDVTKI
420-490
LAYDEKGNKIYFLSTEDLPRRRQLYSANTVGNFNRQCLSCDLVENCTYFSASFSHSMDFFLLKCEGPGVP
490-560
MVTVHNTTDKKKMFDLETNEHVKKAINDRQMPKVEYRDIEIDDYNLPMQILKPATFTDTTHYPLLLVVDG
560-630
TPGSQSVAEKFEVSWETVMVSSHGAVVVKCDGRGSGFQGTKLLHEVRRRLGLLEEKDQMEAVRTMLKEQY
630-700
IDRTRVAVFGKDYGGYLSTYILPAKGENQGQTFTCGSALSPITDFKLYASAFSERYLGLHGLDNRAYEMT
700-770
KVAHRVSALEEQQFLIIHPTADEKIHFQHTAELITQLIRGKANYSLQIYPDESHYFTSSSLKQHLYRSII
770-840
NFFVECFRIQDKLLTVTAKEDEEED
840-865
MASLYQRFTGKINTSRSFPAPPEASHLLGGQGPEEDGGAGAKPLGPRAQAAAPRERGGGGGGAGGRPRFQYQARSDGDEEDELVGSNPPQRNWKGIAIALLVILVICSLIVTSVILLTPAEDNSLSQKKKVTVEDLFSEDFKIHDPEAKWISDTEFIYREQKGTVRLWNVETNTSTVLIEGKKIESLRAIRYEISPDREYALFSYNVEPIYQHSYTGYYVLSKIPHGDPQSLDPPEVSNAKLQYAGWGPKGQQLIFIFENNIYYCAHVGKQAIRVVSTGKEGVIYNGLSDWLYEEEILKTHIAHWWSPDGTRLAYAAINDSRVPIMELPTYTGSIYPTVKPYHYPKAGSENPSISLHVIGLNGPTHDLEMMPPDDPRMREYYITMVKWATSTKVAVTWLNRAQNVSILTLCDATTGVCTKKHEDESEAWLHRQNEEPVFSKDGRKFFFIRAIPQGGRGKFYHITVSSSQPNSSNDNIQSITSGDWDVTKILAYDEKGNKIYFLSTEDLPRRRQLYSANTVGNFNRQCLSCDLVENCTYFSASFSHSMDFFLLKCEGPGVPMVTVHNTTDKKKMFDLETNEHVKKAINDRQMPKVEYRDIEIDDYNLPMQILKPATFTDTTHYPLLLVVDGTPGSQSVAEKFEVSWETVMVSSHGAVVVKCDGRGSGFQGTKLLHEVRRRLGLLEEKDQMEAVRTMLKEQYIDRTRVAVFGKDYGGYLSTYILPAKGENQGQTFTCGSALSPITDFKLYASAFSERYLGLHGLDNRAYEMTKVAHRVSALEEQQFLIIHPTADEKIHFQHTAELITQLIRGKANYSLQIYPDESHYFTSSSLKQHLYRSIINFFVECFRIQDKLLTVTAKEDEEED