You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
ARHGAP39
Rho GTPase-activating protein 39

Protein Summary
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000276826
  • ENSP00000276826
  • ENSG00000147799
  • ENST00000377307
  • ENSP00000366522

Symbol
  • KIAA1688
  • CrGAP
  • Vilse
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
tissue sample
0.7
cell line
0.67
cell type or tissue
0.61
transcription factor perturbation
0.61
protein domain
0.58


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4.58   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 73   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4.58   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 73   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (7)
Axon guidance (R-HSA-422475)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 7
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Axon guidance
Reactome
Developmental Biology
Reactome
Inactivation of CDC42 and RAC1
Reactome
Rho GTPase cycle
Reactome
Signal Transduction
Name
Explore in Pharos
Explore in Source
Axon guidance
Developmental Biology
Inactivation of CDC42 and RAC1
Rho GTPase cycle
Signal Transduction
Gene Ontology Terms (9)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (49)
1 – 10 of 49
CNKSR3
Tbio
Family: Enzyme
Novelty: 0.28155853
p_int: 0.999999995
p_ni: 5e-9
Score: 0.451
Data Source: BioPlex,STRINGDB
PIP
Tbio
Novelty: 0.00268794
p_int: 0.999999919
p_ni: 8.1e-8
Data Source: BioPlex
SPIN2B
Tbio
Novelty: 0.03496843
p_int: 0.999999786
p_ni: 1.37e-7
p_wrong: 7.7e-8
Score: 0.214
Data Source: BioPlex,STRINGDB
ROBO1
Tbio
Novelty: 0.00585838
Score: 0.954
Data Source: Reactome,STRINGDB
CDC42
Tchem
Family: Enzyme
Novelty: 0.00039759
Score: 0.952
Data Source: STRINGDB
SLIT2
Tbio
Novelty: 0.00880909
Score: 0.942
Data Source: Reactome,STRINGDB
RAC3
Tbio
Family: Enzyme
Novelty: 0.05044614
Score: 0.938
Data Source: STRINGDB
RAC1
Tbio
Family: Enzyme
Novelty: 0.00579565
Score: 0.93
Data Source: Reactome,STRINGDB
RHOBTB2
Tbio
Novelty: 0.01298176
Score: 0.927
Data Source: STRINGDB
RHOD
Tbio
Family: Enzyme
Novelty: 0.00359609
Score: 0.927
Data Source: STRINGDB
Publication Statistics
PubMed Score  4.58

PubMed score by year
PubTator Score  0.64

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSQTQDYECRSHNVDLPESRIPGSNTRLEWVEIIEPRTRERMYANLVTGECVWDPPAGVRIKRTSENQWW
1-70
ELFDPNTSRFYYYNASTQRTVWHRPQGCDIIPLAKLQTLKQNTESPRASAESSPGRGSSVSREGSTSSSL
70-140
EPEPDTEKAQELPARAGRPAAFGTVKEDSGSSSPPGVFLEKDYEIYRDYSADGQLLHYRTSSLRWNSGAK
140-210
ERMLIKVADREPSFLAAQGNGYAPDGPPGVRSRRPSGSQHSPSLQTFAPEADGTIFFPERRPSPFLKRAE
210-280
LPGSSSPLLAQPRKPSGDSQPSSPRYGYEPPLYEEPPVEYQAPIYDEPPMDVQFEAGGGYQAGSPQRSPG
280-350
RKPRPFLQPNKQGPPSPCQQLVLTKQKCPERFLSLEYSPAGKEYVRQLVYVEQAGSSPKLRAGPRHKYAP
350-420
NPGGGSYSLQPSPCLLRDQRLGVKSGDYSTMEGPELRHSQPPTPLPQAQEDAMSWSSQQDTLSSTGYSPG
420-490
TRKRKSRKPSLCQATSATPTEGPGDLLVEQPLAEEQPPCGTSLAPVKRAEGEAEGARGAAEPFLAQARLA
490-560
WEAQQAHFHMKQRSSWDSQQDGSGYESDGALPLPMPGPVVRAFSEDEALAQQENRHWRRGTFEKLGFPQI
560-630
LLEKSVSVQTNLASPEPYLHPSQSEDLAACAQFESSRQSRSGVPSSSCVFPTFTLRKPSSETDIENWASK
630-700
HFNKHTQGLFRRKVSIANMLAWSSESIKKPMIVTSDRHVKKEACELFKLIQMYMGDRRAKADPLHVALEV
700-770
ATKGWSVQGLRDELYIQLCRQTTENFRLESLARGWELMAICLAFFPPTPKFHSYLEGYIYRHMDPVNDTK
770-840
GVAISTYAKYCYHKLQKAALTGAKKGLKKPNVEEIRHAKNAVFSPSMFGSALQEVMGMQRERYPERQLPW
840-910
VQTRLSEEVLALNGDQTEGIFRVPGDIDEVNALKLQVDQWKVPTGLEDPHVPASLLKLWYRELEEPLIPH
910-980
EFYEQCIAHYDSPEAAVAVVHALPRINRMVLCYLIRFLQVFVQPANVAVTKMDVSNLAMVMAPNCLRCQS
980-1050
DDPRVIFENTRKEMSFLRVLIQHLDTSFMEGVL
1050-1083
MSQTQDYECRSHNVDLPESRIPGSNTRLEWVEIIEPRTRERMYANLVTGECVWDPPAGVRIKRTSENQWWELFDPNTSRFYYYNASTQRTVWHRPQGCDIIPLAKLQTLKQNTESPRASAESSPGRGSSVSREGSTSSSLEPEPDTEKAQELPARAGRPAAFGTVKEDSGSSSPPGVFLEKDYEIYRDYSADGQLLHYRTSSLRWNSGAKERMLIKVADREPSFLAAQGNGYAPDGPPGVRSRRPSGSQHSPSLQTFAPEADGTIFFPERRPSPFLKRAELPGSSSPLLAQPRKPSGDSQPSSPRYGYEPPLYEEPPVEYQAPIYDEPPMDVQFEAGGGYQAGSPQRSPGRKPRPFLQPNKQGPPSPCQQLVLTKQKCPERFLSLEYSPAGKEYVRQLVYVEQAGSSPKLRAGPRHKYAPNPGGGSYSLQPSPCLLRDQRLGVKSGDYSTMEGPELRHSQPPTPLPQAQEDAMSWSSQQDTLSSTGYSPGTRKRKSRKPSLCQATSATPTEGPGDLLVEQPLAEEQPPCGTSLAPVKRAEGEAEGARGAAEPFLAQARLAWEAQQAHFHMKQRSSWDSQQDGSGYESDGALPLPMPGPVVRAFSEDEALAQQENRHWRRGTFEKLGFPQILLEKSVSVQTNLASPEPYLHPSQSEDLAACAQFESSRQSRSGVPSSSCVFPTFTLRKPSSETDIENWASKHFNKHTQGLFRRKVSIANMLAWSSESIKKPMIVTSDRHVKKEACELFKLIQMYMGDRRAKADPLHVALEVATKGWSVQGLRDELYIQLCRQTTENFRLESLARGWELMAICLAFFPPTPKFHSYLEGYIYRHMDPVNDTKGVAISTYAKYCYHKLQKAALTGAKKGLKKPNVEEIRHAKNAVFSPSMFGSALQEVMGMQRERYPERQLPWVQTRLSEEVLALNGDQTEGIFRVPGDIDEVNALKLQVDQWKVPTGLEDPHVPASLLKLWYRELEEPLIPHEFYEQCIAHYDSPEAAVAVVHALPRINRMVLCYLIRFLQVFVQPANVAVTKMDVSNLAMVMAPNCLRCQSDDPRVIFENTRKEMSFLRVLIQHLDTSFMEGVL