You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
RILPL1
RILP-like protein 1

Protein Summary
Description
Plays a role in the regulation of cell shape and polarity. Plays a role in cellular protein transport, including protein transport away from primary cilia. Neuroprotective protein, which acts by sequestring GAPDH in the cytosol and prevent the apoptotic function of GAPDH in the nucleus. Competes with SIAH1 for binding GAPDH (By similarity). Does not regulate lysosomal morphology and distribution.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000376874
  • ENSP00000366070
  • ENSG00000188026

Symbol
  • RLP1
  • RLP1
  • GOSPEL
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
0.88
histone modification site profile
0.71
transcription factor perturbation
0.68
cell type or tissue
0.64
tissue sample
0.6


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 244.36   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 94   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 244.36   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 94   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (41)
1 – 10 of 41
CMIP
Tbio
Novelty: 0.02011849
p_int: 0.980620782
p_ni: 3.3e-8
p_wrong: 0.019379185
Data Source: BioPlex
TBC1D19
Tdark
Novelty: 6
Score: 0.72
Data Source: STRINGDB
ABCA13
Tbio
Family: Transporter
Novelty: 0.06836876
Score: 0.686
Data Source: STRINGDB
GAPDH
Tchem
Family: Enzyme
Novelty: 0.00019506
Score: 0.664
Data Source: STRINGDB
CDC42EP2
Tbio
Novelty: 0.3489466
Score: 0.637
Data Source: STRINGDB
GLCCI1
Tbio
Novelty: 0.03383863
Score: 0.631
Data Source: STRINGDB
SIAH1
Tbio
Family: Enzyme
Novelty: 0.01035087
Score: 0.63
Data Source: STRINGDB
SYTL1
Tbio
Novelty: 0.12823747
Score: 0.629
Data Source: STRINGDB
RHOT1
Tbio
Family: Enzyme
Novelty: 0.0229606
Score: 0.604
Data Source: STRINGDB
VTA1
Tbio
Novelty: 0.02244131
Score: 0.593
Data Source: STRINGDB
Publication Statistics
PubMed Score  244.36

PubMed score by year
PubTator Score  7.25

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MEEERGSALAAESALEKNVAELTVMDVYDIASLVGHEFERVIDQHGCEAIARLMPKVVRVLEILEVLVSR
1-70
HHVAPELDELRLELDRLRLERMDRIEKERKHQKELELVEDVWRGEAQDLLSQIAQLQEENKQLMTNLSHK
70-140
DVNFSEEEFQKHEGMSERERQVMKKLKEVVDKQRDEIRAKDRELGLKNEDVEALQQQQTRLMKINHDLRH
140-210
RVTVVEAQGKALIEQKVELEADLQTKEQEMGSLRAELGKLRERLQGEHSQNGEEEPETEPVGEESISDAE
210-280
KVAMDLKDPNRPRFTLQELRDVLHERNELKSKVFLLQEELAYYKSEEMEEENRIPQPPPIAHPRTSPQPE
280-350
SGIKRLFSFFSRDKKRLANTQRNVHIQESFGQWANTHRDDGYTEQGQEALQHL
350-403
MEEERGSALAAESALEKNVAELTVMDVYDIASLVGHEFERVIDQHGCEAIARLMPKVVRVLEILEVLVSRHHVAPELDELRLELDRLRLERMDRIEKERKHQKELELVEDVWRGEAQDLLSQIAQLQEENKQLMTNLSHKDVNFSEEEFQKHEGMSERERQVMKKLKEVVDKQRDEIRAKDRELGLKNEDVEALQQQQTRLMKINHDLRHRVTVVEAQGKALIEQKVELEADLQTKEQEMGSLRAELGKLRERLQGEHSQNGEEEPETEPVGEESISDAEKVAMDLKDPNRPRFTLQELRDVLHERNELKSKVFLLQEELAYYKSEEMEEENRIPQPPPIAHPRTSPQPESGIKRLFSFFSRDKKRLANTQRNVHIQESFGQWANTHRDDGYTEQGQEALQHL