You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
TNFRSF1B
Tumor necrosis factor receptor superfamily member 1B

Protein Summary
Description
Receptor with high affinity for TNFSF2/TNF-alpha and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-alpha. The TRAF1/TRAF2 complex recruits the apoptotic suppressors BIRC2 and BIRC3 to TNFRSF1B/TNFR2. This receptor mediates most of the metabolic effects of TNF-alpha. Isoform 2 blocks TNF-alpha-induced apoptosis, which suggests that it regulates TNF-alpha function by antagonizing its biological activity. The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein and TNF-receptor 1 form a heterocomplex that mediates the recruitment of two anti-apoptotic proteins, c-IAP1 and c-IAP2, which possess E3 ubiquitin ligase activity. The function of IAPs in TNF-receptor signalling is unknown, however, c-IAP1 is thought to potentiate TNF-induced apoptosis by the ubiquitination and degradation of TNF-receptor-associated factor 2, which mediates anti-apoptotic signals. Knockout studies in mice also suggest a role of this protein in protecting ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000376259
  • ENSP00000365435
  • ENSG00000028137

Symbol
  • TNFBR
  • TNFR2
  • p75
  • TBPII
  • TNFBR
  • TNFR2
  • CD120b
  • TNFR1B
  • TNFR80
  • TNF-R75
  • p75TNFR
  • TNF-R-II
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
hub protein
0.97
disease perturbation
0.95
PubMedID
0.82
phenotype
0.77
disease
0.76


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5023.87   (req: < 5)
Gene RIFs: 294   (req: <= 3)
Antibodies: 896   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5023.87   (req: >= 5)
Gene RIFs: 294   (req: > 3)
Antibodies: 896   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 25
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (24)
Cytokine Signaling in Immune system (R-HSA-1280215)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 9
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytokine Signaling in Immune system
Reactome
Immune System
Reactome
Innate Immune System
Reactome
Interleukin-10 signaling
Reactome
Interleukin-4 and Interleukin-13 signaling
Name
Explore in Pharos
Explore in Source
Cytokine Signaling in Immune system
Immune System
Innate Immune System
Interleukin-10 signaling
Interleukin-4 and Interleukin-13 signaling
Protein-Protein Interactions (324)
1 – 10 of 324
TNF
Tclin
Novelty: 0.00001974
Score: 0.999
Data Source: Reactome,STRINGDB
TNFRSF1A
Tchem
Novelty: 0.00048442
Score: 0.994
Data Source: STRINGDB
TRAF1
Tbio
Novelty: 0.00703177
Score: 0.983
Data Source: STRINGDB
TRAF2
Tbio
Novelty: 0.01051586
Score: 0.98
Data Source: Reactome,STRINGDB
IL10
Tbio
Novelty: 0.00007359
Score: 0.98
Data Source: STRINGDB
LTA
Tbio
Novelty: 0.00126314
Score: 0.977
Data Source: Reactome,STRINGDB
TRADD
Tbio
Novelty: 0.00842687
Score: 0.971
Data Source: STRINGDB
ADAM17
Tchem
Family: Enzyme
Novelty: 0.00144829
Score: 0.97
Data Source: STRINGDB
TNFSF11
Tclin
Novelty: 0.00023862
Score: 0.968
Data Source: STRINGDB
TRAF3
Tbio
Novelty: 0.00292884
Score: 0.965
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  5023.87

PubMed score by year
PubTator Score  808.57

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAPVAVWAALAVGLELWAAAHALPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKT
1-70
SDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPL
70-140
RKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMA
140-210
PGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGDFALPVGLIVGVTALGLLIIGVVN
210-280
CVIMTQVKKKPLCLQREAKVPHLPADKARGTQGPEQQHLLITAPSSSSSSLESSASALDRRAPTRNQPQA
280-350
PGVEASGAGEARASTGSSDSSPGGHGTQVNVTCIVNVCSSSDHSSQCSSQASSTMGDTDSSPSESPKDEQ
350-420
VPFSKEECAFRSQLETPETLLGSTEEKPLPLGVPDAGMKPS
420-461
MAPVAVWAALAVGLELWAAAHALPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGDFALPVGLIVGVTALGLLIIGVVNCVIMTQVKKKPLCLQREAKVPHLPADKARGTQGPEQQHLLITAPSSSSSSLESSASALDRRAPTRNQPQAPGVEASGAGEARASTGSSDSSPGGHGTQVNVTCIVNVCSSSDHSSQCSSQASSTMGDTDSSPSESPKDEQVPFSKEECAFRSQLETPETLLGSTEEKPLPLGVPDAGMKPS