You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
FOXP3
Forkhead box protein P3

Protein Summary
Description
Transcriptional regulator which is crucial for the development and inhibitory function of regulatory T-cells (Treg). Plays an essential role in maintaining homeostasis of the immune system by allowing the acquisition of full suppressive function and stability of the Treg lineage, and by directly modulating the expansion and function of conventional T-cells. Can act either as a transcriptional repressor or a transcriptional activator depending on its interactions with other transcription factors, histone acetylases and deacetylases. The suppressive activity of Treg involves the coordinate activation of many genes, including CTLA4 and TNFRSF18 by FOXP3 along with repression of genes encoding cytokines such as interleukin-2 (IL2) and interferon-gamma (IFNG). Inhibits cytokine production and T-cell effector function by repressing the activity of two key transcription factors, RELA and NFATC2 (PubMed:15790681). Mediates transcriptional repression of IL2 via its association with histone acet ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000376199
  • ENSP00000365372
  • ENSG00000049768
  • ENST00000376207
  • ENSP00000365380
  • ENST00000518685
  • ENSP00000428952
  • ENST00000557224
  • ENSP00000451208

Symbol
  • IPEX
  • JM2
  • AIID
  • IPEX
  • PIDX
  • XPID
  • DIETER
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
molecular function
0.95
protein domain
0.85
tissue sample
0.77
tissue
0.69


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 6655.42   (req: < 5)
Gene RIFs: 845   (req: <= 3)
Antibodies: 1751   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 6655.42   (req: >= 5)
Gene RIFs: 845   (req: > 3)
Antibodies: 1751   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 65
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (13)
Gene expression (Transcription) (R-HSA-74160)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Gene expression (Transcription)
Reactome
Generic Transcription Pathway
Reactome
RNA Polymerase II Transcription
Reactome
RUNX1 and FOXP3 control the development of regulatory T lymphocytes (Tregs)
Reactome
RUNX1 regulates transcription of genes involved in WNT signaling
Name
Explore in Pharos
Explore in Source
Gene expression (Transcription)
Generic Transcription Pathway
RNA Polymerase II Transcription
RUNX1 and FOXP3 control the development of regulatory T lymphocytes (Tregs)
RUNX1 regulates transcription of genes involved in WNT signaling
Gene Ontology Terms (69)
Items per page:
10
1 – 10 of 13
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Mutant Phenotype (IMP)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence Alignment (ISA)
NTNU_SB
Non-traceable Author Statement (NAS)
UniProtKB
Protein-Protein Interactions (490)
1 – 10 of 490
FOXP1
Tbio
Family: TF
Novelty: 0.00422423
p_int: 0.999999837
p_ni: 1.63e-7
p_wrong: 1e-9
Score: 0.867
Data Source: BioPlex,STRINGDB
FOXP4
Tbio
Family: TF
Novelty: 0.04123592
p_int: 0.999999641
p_ni: 3.58e-7
p_wrong: 1e-9
Score: 0.885
Data Source: BioPlex,STRINGDB
FOXP2
Tbio
Family: TF
Novelty: 0.00277727
p_int: 0.999996603
p_ni: 8.69e-7
p_wrong: 0.000002528
Score: 0.846
Data Source: BioPlex,STRINGDB
SMYD2
Tchem
Family: Epigenetic
Novelty: 0.01010557
p_int: 0.983967596
p_ni: 0.006727601
p_wrong: 0.009304803
Score: 0.275
Data Source: BioPlex,STRINGDB
CDC23
Tbio
Novelty: 0.02675154
p_int: 0.834284016
p_ni: 0.164135445
p_wrong: 0.001580539
Score: 0.208
Data Source: BioPlex,STRINGDB
CTLA4
Tclin
Novelty: 0.00017405
Score: 0.997
Data Source: STRINGDB
IL2
Tchem
Novelty: 0.00004362
Score: 0.997
Data Source: STRINGDB
NFATC2
Tbio
Family: TF
Novelty: 0.00358612
Score: 0.996
Data Source: Reactome,STRINGDB
TNFRSF18
Tbio
Novelty: 0.00518763
Score: 0.993
Data Source: STRINGDB
IFNG
Tclin
Novelty: 0.00011491
Score: 0.986
Data Source: STRINGDB
Publication Statistics
PubMed Score  6655.42

PubMed score by year
PubTator Score  4143.97

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPNPRPGKPSAPSLALGPSPGASPSWRAAPKASDLLGARGPGGTFQGRDLRGGAHASSSSLNPMPPSQLQ
1-70
LPTLPLVMVAPSGARLGPLPHLQALLQDRPHFMHQLSTVDAHARTPVLQVHPLESPAMISLTPPTTATGV
70-140
FSLKARPGLPPGINVASLEWVSREPALLCTFPNPSAPRKDSTLSAVPQSSYPLLANGVCKWPGCEKVFEE
140-210
PEDFLKHCQADHLLDEKGRAQCLLQREMVQSLEQQLVLEKEKLSAMQAHLAGKMALTKASSVASSDKGSC
210-280
CIVAAGSQGPVVPAWSGPREAPDSLFAVRRHLWGSHGNSTFPEFLHNMDYFKFHNMRPPFTYATLIRWAI
280-350
LEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDELEFRKKRSQR
350-420
PSRCSNPTPGP
420-431
MPNPRPGKPSAPSLALGPSPGASPSWRAAPKASDLLGARGPGGTFQGRDLRGGAHASSSSLNPMPPSQLQLPTLPLVMVAPSGARLGPLPHLQALLQDRPHFMHQLSTVDAHARTPVLQVHPLESPAMISLTPPTTATGVFSLKARPGLPPGINVASLEWVSREPALLCTFPNPSAPRKDSTLSAVPQSSYPLLANGVCKWPGCEKVFEEPEDFLKHCQADHLLDEKGRAQCLLQREMVQSLEQQLVLEKEKLSAMQAHLAGKMALTKASSVASSDKGSCCIVAAGSQGPVVPAWSGPREAPDSLFAVRRHLWGSHGNSTFPEFLHNMDYFKFHNMRPPFTYATLIRWAILEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDELEFRKKRSQRPSRCSNPTPGP