You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
AGMAT
Agmatinase, mitochondrial

Protein Summary
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000375826
  • ENSP00000364986
  • ENSG00000116771
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
small molecule perturbation
0.62
histone modification site profile
0.59
protein domain
0.58
cell type or tissue
0.51
microRNA
0.48


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 15.24   (req: < 5)
Gene RIFs: 10   (req: <= 3)
Antibodies: 87   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 15.24   (req: >= 5)
Gene RIFs: 10   (req: > 3)
Antibodies: 87   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (7)
Agmatine biosynthesis (R-HSA-351143)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Agmatine biosynthesis
Reactome
Metabolism
Reactome
Metabolism of amino acids and derivatives
Reactome
Metabolism of polyamines
Name
Explore in Pharos
Explore in Source
Agmatine biosynthesis
Metabolism
Metabolism of amino acids and derivatives
Metabolism of polyamines
Gene Ontology Terms (6)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
Reactome
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (86)
1 – 10 of 86
FNTA
Tbio
Family: Enzyme
Novelty: 0.04343929
p_int: 0.999999375
p_ni: 1.26e-7
p_wrong: 4.99e-7
Data Source: BioPlex
BTBD1
Tbio
Novelty: 0.32684825
p_int: 0.908367107
p_ni: 0.076664618
p_wrong: 0.014968275
Score: 0.169
Data Source: BioPlex,STRINGDB
DPF3
Tbio
Family: Epigenetic
Novelty: 0.09141321
p_int: 0.831199711
p_ni: 0.003806056
p_wrong: 0.164994233
Score: 0.188
Data Source: BioPlex,STRINGDB
ACAD9
Tbio
Family: Enzyme
Novelty: 0.0452113
p_int: 0.764617096
p_ni: 0.235382904
Score: 0.199
Data Source: BioPlex,STRINGDB
AZIN2
Tbio
Family: Enzyme
Novelty: 0.00985172
Score: 0.993
Data Source: STRINGDB
ODC1
Tclin
Family: Enzyme
Novelty: 0.00041795
Score: 0.983
Data Source: STRINGDB
SRM
Tchem
Family: Enzyme
Novelty: 0.01779825
Score: 0.978
Data Source: STRINGDB
AOC1
Tchem
Family: Enzyme
Novelty: 0.00142124
Score: 0.953
Data Source: STRINGDB
SAT1
Tbio
Family: Enzyme
Novelty: 0.00277678
Score: 0.941
Data Source: STRINGDB
SAT2
Tbio
Family: Enzyme
Novelty: 0.09330223
Score: 0.907
Data Source: STRINGDB
Publication Statistics
PubMed Score  15.24

PubMed score by year
PubTator Score  21.01

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MLRLLASGCARGPGPGVGARPAAGLFHPGRRQSRQASDAPRNQPPSPEFVARPVGVCSMMRLPVQTSPEG
1-70
LDAAFIGVPLDTGTSNRPGARFGPRRIREESVMLGTVNPSTGALPFQSLMVADLGDVNVNLYNLQDSCRR
70-140
IQEAYEKIVAAGCIPLTLGGDHTITYPILQAMAKKHGPVGLLHVDAHTDTTDKALGEKLYHGAPFRRCVD
140-210
EGLLDCKRVVQIGIRGSSTTLDPYRYNRSQGFRVVLAEDCWMKSLVPLMGEVRQQMGGKPIYISFDIDAL
210-280
DPAYAPGTGTPEIAGLTPSQALEIIRGCQGLNVMGCDLVEVSPPYDLSGNTALLAANLLFEMLCALPKVT
280-350
TV
350-352
MLRLLASGCARGPGPGVGARPAAGLFHPGRRQSRQASDAPRNQPPSPEFVARPVGVCSMMRLPVQTSPEGLDAAFIGVPLDTGTSNRPGARFGPRRIREESVMLGTVNPSTGALPFQSLMVADLGDVNVNLYNLQDSCRRIQEAYEKIVAAGCIPLTLGGDHTITYPILQAMAKKHGPVGLLHVDAHTDTTDKALGEKLYHGAPFRRCVDEGLLDCKRVVQIGIRGSSTTLDPYRYNRSQGFRVVLAEDCWMKSLVPLMGEVRQQMGGKPIYISFDIDALDPAYAPGTGTPEIAGLTPSQALEIIRGCQGLNVMGCDLVEVSPPYDLSGNTALLAANLLFEMLCALPKVTTV