You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
CLCNKB
Chloride channel protein ClC-Kb

Protein Summary
Description
Voltage-gated chloride channel. Chloride channels have several functions including the regulation of cell volume; membrane potential stabilization, signal transduction and transepithelial transport. May be important in urinary concentrating mechanisms. The protein encoded by this gene is a member of the family of voltage-gated chloride channels. Chloride channels have several functions, including the regulation of cell volume, membrane potential stabilization, signal transduction and transepithelial transport. This gene is expressed predominantly in the kidney and may be important for renal salt reabsorption. Mutations in this gene are associated with autosomal recessive Bartter syndrome type 3 (BS3). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000375667
  • ENSP00000364819
  • ENSG00000184908
  • ENST00000375679
  • ENSP00000364831

Symbol
  • CLCKB
  • ClC-K2
  • ClC-Kb
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.81
cell type or tissue
0.68
tissue sample
0.67
cell line
0.65
disease perturbation
0.62


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 90.33   (req: < 5)
Gene RIFs: 40   (req: <= 3)
Antibodies: 128   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 90.33   (req: >= 5)
Gene RIFs: 40   (req: > 3)
Antibodies: 128   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 1
Approved Drugs (1)
1 – 1 of 1
niflumic acid
chemical structure image
Pathways (4)
Ion channel transport (R-HSA-983712)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Ion channel transport
Reactome
Stimuli-sensing channels
Reactome
Transport of small molecules
Name
Explore in Pharos
Explore in Source
Ion channel transport
Stimuli-sensing channels
Transport of small molecules
Gene Ontology Terms (8)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
Reactome
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (77)
1 – 10 of 77
BSND
Tbio
Novelty: 0.01946418
Score: 0.995
Data Source: Reactome,STRINGDB
KCNJ1
Tchem
Family: IC
Novelty: 0.00310316
Score: 0.871
Data Source: STRINGDB
SLC12A1
Tclin
Family: Transporter
Novelty: 0.00394411
Score: 0.85
Data Source: STRINGDB
SLC12A3
Tclin
Family: Transporter
Novelty: 0.0014922
Score: 0.81
Data Source: STRINGDB
ANO1
Tclin
Family: IC
Novelty: 0.00174202
Score: 0.772
Data Source: STRINGDB
KLF15
Tbio
Family: TF
Novelty: 0.01168692
Score: 0.711
Data Source: STRINGDB
CASR
Tclin
Family: GPCR
Novelty: 0.00066875
Score: 0.7
Data Source: STRINGDB
ANO2
Tbio
Family: IC
Novelty: 0.01113226
Score: 0.659
Data Source: STRINGDB
TTYH1
Tbio
Family: IC
Novelty: 0.08522727
Score: 0.64
Data Source: STRINGDB
CFTR
Tclin
Family: IC
Novelty: 0.00015058
Score: 0.635
Data Source: STRINGDB
Publication Statistics
PubMed Score  90.33

PubMed score by year
PubTator Score  90.51

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MEEFVGLREGSSGNPVTLQELWGPCPRIRRGIRGGLEWLKQKLFRLGEDWYFLMTLGVLMALVSCAMDLA
1-70
VESVVRAHQWLYREIGDSHLLRYLSWTVYPVALVSFSSGFSQSITPSSGGSGIPEVKTMLAGVVLEDYLD
70-140
IKNFGAKVVGLSCTLACGSTLFLGKVGPFVHLSVMMAAYLGRVRTTTIGEPENKSKQNEMLVAAAAVGVA
140-210
TVFAAPFSGVLFSIEVMSSHFSVWDYWRGFFAATCGAFMFRLLAVFNSEQETITSLYKTSFRVDVPFDLP
210-280
EIFFFVALGGLCGILGSAYLFCQRIFFGFIRNNRFSSKLLATSKPVYSALATLVLASITYPPSAGRFLAS
280-350
RLSMKQHLDSLFDNHSWALMTQNSSPPWPEELDPQHLWWEWYHPRFTIFGTLAFFLVMKFWMLILATTIP
350-420
MPAGYFMPIFVYGAAIGRLFGETLSFIFPEGIVAGGITNPIMPGGYALAGAAAFSGAVTHTISTALLAFE
420-490
VTGQIVHALPVLMAVLAANAIAQSCQPSFYDGTVIVKKLPYLPRILGRNIGSHRVRVEHFMNHSITTLAK
490-560
DMPLEEVVKVVTSTDVAKYPLVESTESQILVGIVRRAQLVQALKAEPPSWAPGHQQCLQDILAAGCPTEP
560-630
VTLKLSPETSLHEAHNLFELLNLHSLFVTSRGRAVGCVSWVEMKKAISNLTNPPAPK
630-687
MEEFVGLREGSSGNPVTLQELWGPCPRIRRGIRGGLEWLKQKLFRLGEDWYFLMTLGVLMALVSCAMDLAVESVVRAHQWLYREIGDSHLLRYLSWTVYPVALVSFSSGFSQSITPSSGGSGIPEVKTMLAGVVLEDYLDIKNFGAKVVGLSCTLACGSTLFLGKVGPFVHLSVMMAAYLGRVRTTTIGEPENKSKQNEMLVAAAAVGVATVFAAPFSGVLFSIEVMSSHFSVWDYWRGFFAATCGAFMFRLLAVFNSEQETITSLYKTSFRVDVPFDLPEIFFFVALGGLCGILGSAYLFCQRIFFGFIRNNRFSSKLLATSKPVYSALATLVLASITYPPSAGRFLASRLSMKQHLDSLFDNHSWALMTQNSSPPWPEELDPQHLWWEWYHPRFTIFGTLAFFLVMKFWMLILATTIPMPAGYFMPIFVYGAAIGRLFGETLSFIFPEGIVAGGITNPIMPGGYALAGAAAFSGAVTHTISTALLAFEVTGQIVHALPVLMAVLAANAIAQSCQPSFYDGTVIVKKLPYLPRILGRNIGSHRVRVEHFMNHSITTLAKDMPLEEVVKVVTSTDVAKYPLVESTESQILVGIVRRAQLVQALKAEPPSWAPGHQQCLQDILAAGCPTEPVTLKLSPETSLHEAHNLFELLNLHSLFVTSRGRAVGCVSWVEMKKAISNLTNPPAPK