You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
FBXO42
F-box only protein 42

Protein Summary
Description
Substrate-recognition component of some SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex. Specifically recognizes p53/TP53, promoting its ubiquitination and degradation. Members of the F-box protein family, such as FBXO42, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (SKP1A; MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM, Dec 2010]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000375592
  • ENSP00000364742
  • ENSG00000037637

Symbol
  • FBX42
  • JFK
  • KIAA1332
  • JFK
  • Fbx42
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
0.9
transcription factor binding site profile
0.85
disease perturbation
0.79
cell type or tissue
0.78
histone modification site profile
0.74


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 79.25   (req: < 5)
Gene RIFs: 4   (req: <= 3)
Antibodies: 272   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 79.25   (req: >= 5)
Gene RIFs: 4   (req: > 3)
Antibodies: 272   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (50)
1 – 10 of 50
RBPJ
Tbio
Family: TF
Novelty: 0.00198074
p_int: 1
Score: 0.567
Data Source: BioPlex,STRINGDB
GSK3A
Tclin
Family: Kinase
Novelty: 0.01538406
p_int: 0.999935093
p_ni: 0.000064897
p_wrong: 1e-8
Score: 0.343
Data Source: BioPlex,STRINGDB
ROCK2
Tclin
Family: Kinase
Novelty: 0.00286446
p_int: 0.999775981
p_ni: 0.000224019
Score: 0.318
Data Source: BioPlex,STRINGDB
CUL1
Tbio
Novelty: 0.00339576
p_int: 0.999679246
p_ni: 0.000320754
Score: 0.617
Data Source: BioPlex,STRINGDB
SKP1
Tbio
Family: Enzyme
Novelty: 0.00209659
p_int: 0.999674203
p_ni: 0.000325796
p_wrong: 2e-9
Score: 0.715
Data Source: BioPlex,STRINGDB
RAB28
Tbio
Family: Enzyme
Novelty: 0.13110275
p_int: 0.99957023
p_ni: 3e-8
p_wrong: 0.00042974
Score: 0.63
Data Source: BioPlex,STRINGDB
CCDC6
Tbio
Novelty: 0.01216915
p_int: 0.995439649
p_ni: 0.004560351
Data Source: BioPlex
CST1
Tbio
Novelty: 0.02481888
p_int: 0.98911974
p_ni: 0.006578109
p_wrong: 0.004302151
Data Source: BioPlex
TTC9C
Tdark
Novelty: 10
p_int: 0.987568325
p_ni: 0.012431476
p_wrong: 1.98e-7
Data Source: BioPlex
KLK6
Tchem
Family: Enzyme
Novelty: 0.00617471
p_int: 0.941217559
p_ni: 0.05866974
p_wrong: 0.000112701
Score: 0.187
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  79.25

PubMed score by year
PubTator Score  3.88

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MASSSDSEDDSFMAVDQEETVLEGTMDQDEEPHPVLEAEETRHNRSMSELPEEVLEYILSFLSPYQEHKT
1-70
AALVCKQWYRLIKGVAHQCYHGFMKAVQEGNIQWESRTYPYPGTPITQRFSHSACYYDANQSMYVFGGCT
70-140
QSSCNAAFNDLWRLDLNSKEWIRPLASGSYPSPKAGATLVVYKDLLVLFGGWTRPSPYPLHQPERFFDEI
140-210
HTYSPSKNWWNCIVTTHGPPPMAGHSSCVIDDKMIVFGGSLGSRQMSNDVWVLDLEQWAWSKPNISGPSP
210-280
HPRGGQSQIVIDDATILILGGCGGPNALFKDAWLLHMHSGPWAWQPLKVENEEHGAPELWCHPACRVGQC
280-350
VVVFSQAPSGRAPLSPSLNSRPSPISATPPALVPETREYRSQSPVRSMDEAPCVNGRWGTLRPRAQRQTP
350-420
SGSREGSLSPARGDGSPILNGGSLSPGTAAVGGSSLDSPVQAISPSTPSAPEGYDLKIGLSLAPRRGSLP
420-490
DQKDLRLGSIDLNWDLKPASSSNPMDGMDNRTVGGSMRHPPEQTNGVHTPPHVASALAGAVSPGALRRSL
490-560
EAIKAMSSKGPSASAALSPPLGSSPGSPGSQSLSSGETVPIPRPGPAQGDGHSLPPIARRLGHHPPQSLN
560-630
VGKPLYQSMNCKPMQMYVLDIKDTKEKGRVKWKVFNSSSVVGPPETSLHTVVQGRGELIIFGGLMDKKQN
630-700
VKYYPKTNALYFVRAKR
700-717
MASSSDSEDDSFMAVDQEETVLEGTMDQDEEPHPVLEAEETRHNRSMSELPEEVLEYILSFLSPYQEHKTAALVCKQWYRLIKGVAHQCYHGFMKAVQEGNIQWESRTYPYPGTPITQRFSHSACYYDANQSMYVFGGCTQSSCNAAFNDLWRLDLNSKEWIRPLASGSYPSPKAGATLVVYKDLLVLFGGWTRPSPYPLHQPERFFDEIHTYSPSKNWWNCIVTTHGPPPMAGHSSCVIDDKMIVFGGSLGSRQMSNDVWVLDLEQWAWSKPNISGPSPHPRGGQSQIVIDDATILILGGCGGPNALFKDAWLLHMHSGPWAWQPLKVENEEHGAPELWCHPACRVGQCVVVFSQAPSGRAPLSPSLNSRPSPISATPPALVPETREYRSQSPVRSMDEAPCVNGRWGTLRPRAQRQTPSGSREGSLSPARGDGSPILNGGSLSPGTAAVGGSSLDSPVQAISPSTPSAPEGYDLKIGLSLAPRRGSLPDQKDLRLGSIDLNWDLKPASSSNPMDGMDNRTVGGSMRHPPEQTNGVHTPPHVASALAGAVSPGALRRSLEAIKAMSSKGPSASAALSPPLGSSPGSPGSQSLSSGETVPIPRPGPAQGDGHSLPPIARRLGHHPPQSLNVGKPLYQSMNCKPMQMYVLDIKDTKEKGRVKWKVFNSSSVVGPPETSLHTVVQGRGELIIFGGLMDKKQNVKYYPKTNALYFVRAKR