You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
HLA-DQB1
HLA class II histocompatibility antigen, DQ beta 1 chain

Protein Summary
Description
Binds peptides derived from antigens that access the endocytic route of antigen presenting cells (APC) and presents them on the cell surface for recognition by the CD4 T-cells. The peptide binding cleft accommodates peptides of 10-30 residues. The peptides presented by MHC class II molecules are generated mostly by degradation of proteins that access the endocytic route, where they are processed by lysosomal proteases and other hydrolases. Exogenous antigens that have been endocytosed by the APC are thus readily available for presentation via MHC II molecules, and for this reason this antigen presentation pathway is usually referred to as exogenous. As membrane proteins on their way to degradation in lysosomes as part of their normal turn-over are also contained in the endosomal/lysosomal compartments, exogenous antigens must compete with those derived from endogenous components. Autophagy is also a source of endogenous peptides, autophagosomes constitutively fuse with MHC class II loa ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000399088
  • ENSP00000382038
  • ENSG00000231286
  • ENST00000413089
  • ENSP00000396539
  • ENST00000416192
  • ENSP00000410107
  • ENSG00000233209
  • ENST00000419914
  • ENSP00000402865
  • ENSG00000225824
  • ENST00000422950
  • ENSP00000414079
  • ENST00000424806
  • ENSP00000410330

Symbol
  • HLA-DQB
  • IDDM1
  • CELIAC1
  • HLA-DQB
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological term
1
disease
0.94
protein domain
0.92
gene perturbation
0.91
PubMedID
0.89


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 505.6   (req: < 5)
Gene RIFs: 475   (req: <= 3)
Antibodies: 0   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 505.6   (req: >= 5)
Gene RIFs: 475   (req: > 3)
Antibodies: 0   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (10)
1 – 5 of 10
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (60)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 13
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Costimulation by the CD28 family
Reactome
Cytokine Signaling in Immune system
Reactome
Downstream TCR signaling
Reactome
Generation of second messenger molecules
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Costimulation by the CD28 family
Cytokine Signaling in Immune system
Downstream TCR signaling
Generation of second messenger molecules
Gene Ontology Terms (20)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Non-traceable Author Statement (NAS)
UniProtKB
Protein-Protein Interactions (324)
1 – 10 of 324
TAPBP
Tbio
Novelty: 0.00308518
p_int: 0.999993769
p_ni: 0.000006177
p_wrong: 5.4e-8
Score: 0.24
Data Source: BioPlex,STRINGDB
NDUFB8
Tclin
Family: Enzyme
Novelty: 0.00723117
p_int: 0.967514466
p_ni: 0.032485084
p_wrong: 4.5e-7
Score: 0.196
Data Source: BioPlex,STRINGDB
DNAJB9
Tbio
Novelty: 0.00792417
p_int: 0.959783514
p_ni: 0.037577627
p_wrong: 0.002638859
Data Source: BioPlex
NDUFA12
Tclin
Family: Enzyme
Novelty: 0.09669992
p_int: 0.944159244
p_ni: 0.055836333
p_wrong: 0.000004423
Data Source: BioPlex
KCNJ8
Tbio
Family: IC
Novelty: 0.00457979
p_int: 0.920219093
p_ni: 0.079780907
Data Source: BioPlex
NDUFB9
Tclin
Family: Enzyme
Novelty: 0.00352516
p_int: 0.916087393
p_ni: 0.08391175
p_wrong: 8.57e-7
Data Source: BioPlex
CPT1A
Tchem
Family: Enzyme
Novelty: 0.0039233
p_int: 0.853049534
p_ni: 0.146950466
Data Source: BioPlex
SEMA4F
Tbio
Novelty: 0.02764609
p_int: 0.804201707
p_ni: 0.195798071
p_wrong: 2.22e-7
Data Source: BioPlex
NPC2
Tbio
Novelty: 0.00487879
p_int: 0.768786134
p_ni: 0.230953938
p_wrong: 0.000259928
Data Source: BioPlex
MOGS
Tbio
Family: Enzyme
Novelty: 0.00521537
p_int: 0.765207067
p_ni: 0.234792933
Data Source: BioPlex
Publication Statistics
PubMed Score  505.60

PubMed score by year
PubTator Score  2206.57

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSWKKALRIPGGLRAATVTLMLAMLSTPVAEGRDSPEDFVYQFKAMCYFTNGTERVRYVTRYIYNREEYA
1-70
RFDSDVEVYRAVTPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEA
70-140
LNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQHGDVYTCHVEHP
140-210
SLQNPITVEWRAQSESAQSKMLSGIGGFVLGLIFLGLGLIIHHRSQKGLLH
210-261
MSWKKALRIPGGLRAATVTLMLAMLSTPVAEGRDSPEDFVYQFKAMCYFTNGTERVRYVTRYIYNREEYARFDSDVEVYRAVTPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQHGDVYTCHVEHPSLQNPITVEWRAQSESAQSKMLSGIGGFVLGLIFLGLGLIIHHRSQKGLLH