You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
MBL2
Mannose-binding protein C

Protein Classes
Protein Summary
Description
Calcium-dependent lectin involved in innate immune defense. Binds mannose, fucose and N-acetylglucosamine on different microorganisms and activates the lectin complement pathway. Binds to late apoptotic cells, as well as to apoptotic blebs and to necrotic cells, but not to early apoptotic cells, facilitating their uptake by macrophages. May bind DNA. This gene encodes the soluble mannose-binding lectin or mannose-binding protein found in serum. The protein encoded belongs to the collectin family and is an important element in the innate immune system. The protein recognizes mannose and N-acetylglucosamine on many microorganisms, and is capable of activating the classical complement pathway. Deficiencies of this gene have been associated with susceptibility to autoimmune and infectious diseases. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000373968
  • ENSP00000363079
  • ENSG00000165471

Symbol
  • COLEC1
  • MBL
  • MBL
  • MBP
  • MBP1
  • MBPD
  • MBL2D
  • MBP-C
  • COLEC1
  • HSMBPC
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological term
1
disease
0.77
gene perturbation
0.76
protein domain
0.73
cell type or tissue
0.7


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 562.27   (req: < 5)
Gene RIFs: 523   (req: <= 3)
Antibodies: 680   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 562.27   (req: >= 5)
Gene RIFs: 523   (req: > 3)
Antibodies: 680   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 19
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (63)
Complement cascade (R-HSA-166658)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Complement cascade
Reactome
Creation of C4 and C2 activators
Reactome
Immune System
Reactome
Initial triggering of complement
Reactome
Innate Immune System
Name
Explore in Pharos
Explore in Source
Complement cascade
Creation of C4 and C2 activators
Immune System
Initial triggering of complement
Innate Immune System
Protein-Protein Interactions (141)
1 – 10 of 141
TRMU
Tbio
Family: Enzyme
Novelty: 0.00469463
p_int: 0.999999821
p_ni: 8.2e-8
p_wrong: 9.7e-8
Data Source: BioPlex
FCN2
Tbio
Novelty: 0.00608839
Score: 0.994
Data Source: STRINGDB
MASP1
Tbio
Family: Enzyme
Novelty: 0.00306091
Score: 0.99
Data Source: Reactome,STRINGDB
MASP2
Tbio
Family: Enzyme
Novelty: 0.00589925
Score: 0.99
Data Source: Reactome,STRINGDB
FCN3
Tbio
Novelty: 0.00979596
Score: 0.988
Data Source: STRINGDB
C4A
Tbio
Novelty: 0.00075974
Score: 0.97
Data Source: Reactome,STRINGDB
C4B
Tbio
Novelty: 0.00094534
Score: 0.97
Data Source: Reactome,STRINGDB
C2
Tbio
Novelty: 0.01346942
Score: 0.955
Data Source: Reactome,STRINGDB
FCN1
Tbio
Novelty: 0.01220815
Score: 0.938
Data Source: STRINGDB
COLEC11
Tbio
Novelty: 0.03321517
Score: 0.92
Data Source: STRINGDB
Publication Statistics
PubMed Score  562.27

PubMed score by year
PubTator Score  1501.85

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQ
1-70
GPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFL
70-140
TNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNE
140-210
GEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI
210-248
MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI