You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
YARS
Tyrosine--tRNA ligase, cytoplasmic

Protein Summary
Description
Catalyzes the attachment of tyrosine to tRNA(Tyr) in a two-step reaction: tyrosine is first activated by ATP to form Tyr-AMP and then transferred to the acceptor end of tRNA(Tyr). Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Tyrosyl-tRNA synthetase belongs to the class I tRNA synthetase family. Cytokine activities have also been observed for the human tyrosyl-tRNA synthetase, after it is split into two parts, an N-terminal fragment that harbors the catalytic site and a C-terminal fragment found only in the mammalian enzyme. The N-terminal fragment is an interleukin-8-like cytokine, whereas the released C-terminal fragment is an EMAP II-like cytokine. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000373477
  • ENSP00000362576
  • ENSG00000134684

Symbol
  • YRS
  • YTS
  • TYRRS
  • CMTDIC
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.99
kinase perturbation
0.98
transcription factor binding site profile
0.94
co-expressed gene
0.87
disease perturbation
0.87


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 292.95   (req: < 5)
Gene RIFs: 28   (req: <= 3)
Antibodies: 242   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 292.95   (req: >= 5)
Gene RIFs: 28   (req: > 3)
Antibodies: 242   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 17
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (7)
1 – 5 of 7
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (6)
Cytosolic tRNA aminoacylation (R-HSA-379716)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytosolic tRNA aminoacylation
Reactome
Metabolism of proteins
Reactome
Translation
Reactome
tRNA Aminoacylation
Name
Explore in Pharos
Explore in Source
Cytosolic tRNA aminoacylation
Metabolism of proteins
Translation
tRNA Aminoacylation
Gene Ontology Terms (14)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (489)
1 – 10 of 489
TRIM5
Tbio
Novelty: 0.00503943
p_int: 0.927657076
p_ni: 0.072342924
Score: 0.516
Data Source: BioPlex,STRINGDB
GTF2E2
Tbio
Novelty: 0.16730745
p_int: 0.794309817
p_ni: 0.205690183
Score: 0.177
Data Source: BioPlex,STRINGDB
EPRS
Tchem
Family: Enzyme
Novelty: 0.00072148
Score: 0.998
Data Source: STRINGDB
QARS
Tchem
Family: Enzyme
Novelty: 0.02294313
Score: 0.997
Data Source: STRINGDB
MARS
Tchem
Family: Enzyme
Novelty: 0.01986188
Score: 0.993
Data Source: STRINGDB
AARS
Tbio
Family: Enzyme
Novelty: 0.0027376
Score: 0.99
Data Source: STRINGDB
IARS
Tchem
Family: Enzyme
Novelty: 0.0033571
Score: 0.988
Data Source: STRINGDB
CARS
Tbio
Family: Enzyme
Novelty: 0.02910314
Score: 0.986
Data Source: STRINGDB
LARS
Tchem
Family: Enzyme
Novelty: 0.00167582
Score: 0.986
Data Source: STRINGDB
KARS
Tchem
Family: Enzyme
Novelty: 0.00319409
Score: 0.985
Data Source: STRINGDB
Publication Statistics
PubMed Score  292.95

PubMed score by year
PubTator Score  46.89

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGDAPSPEEKLHLITRNLQEVLGEEKLKEILKERELKIYWGTATTGKPHVAYFVPMSKIADFLKAGCEVT
1-70
ILFADLHAYLDNMKAPWELLELRVSYYENVIKAMLESIGVPLEKLKFIKGTDYQLSKEYTLDVYRLSSVV
70-140
TQHDSKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGIDQRKIFTFAEKYLPALGYSKRVHL
140-210
MNPMVPGLTGSKMSSSEEESKIDLLDRKEDVKKKLKKAFCEPGNVENNGVLSFIKHVLFPLKSEFVILRD
210-280
EKWGGNKTYTAYVDLEKDFAAEVVHPGDLKNSVEVALNKLLDPIREKFNTPALKKLASAAYPDPSKQKPM
280-350
AKGPAKNSEPEEVIPSRLDIRVGKIITVEKHPDADSLYVEKIDVGEAEPRTVVSGLVQFVPKEELQDRLV
350-420
VVLCNLKPQKMRGVESQGMLLCASIEGINRQVEPLDPPAGSAPGEHVFVKGYEKGQPDEELKPKKKVFEK
420-490
LQADFKISEECIAQWKQTNFMTKLGSISCKSLKGGNIS
490-528
MGDAPSPEEKLHLITRNLQEVLGEEKLKEILKERELKIYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNMKAPWELLELRVSYYENVIKAMLESIGVPLEKLKFIKGTDYQLSKEYTLDVYRLSSVVTQHDSKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGIDQRKIFTFAEKYLPALGYSKRVHLMNPMVPGLTGSKMSSSEEESKIDLLDRKEDVKKKLKKAFCEPGNVENNGVLSFIKHVLFPLKSEFVILRDEKWGGNKTYTAYVDLEKDFAAEVVHPGDLKNSVEVALNKLLDPIREKFNTPALKKLASAAYPDPSKQKPMAKGPAKNSEPEEVIPSRLDIRVGKIITVEKHPDADSLYVEKIDVGEAEPRTVVSGLVQFVPKEELQDRLVVVLCNLKPQKMRGVESQGMLLCASIEGINRQVEPLDPPAGSAPGEHVFVKGYEKGQPDEELKPKKKVFEKLQADFKISEECIAQWKQTNFMTKLGSISCKSLKGGNIS