You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
STXBP1
Syntaxin-binding protein 1

Protein Summary
Description
May participate in the regulation of synaptic vesicle docking and fusion, possibly through interaction with GTP-binding proteins. Essential for neurotransmission and binds syntaxin, a component of the synaptic vesicle fusion machinery probably in a 1:1 ratio. Can interact with syntaxins 1, 2, and 3 but not syntaxin 4. May play a role in determining the specificity of intracellular fusion reactions. This gene encodes a syntaxin-binding protein. The encoded protein appears to play a role in release of neurotransmitters via regulation of syntaxin, a transmembrane attachment protein receptor. Mutations in this gene have been associated with infantile epileptic encephalopathy-4. Alternatively spliced transcript variants have been described. [provided by RefSeq, Feb 2010]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000373299
  • ENSP00000362396
  • ENSG00000136854
  • ENST00000373302
  • ENSP00000362399

Symbol
  • UNC18A
  • P67
  • NSEC1
  • UNC18
  • RBSEC1
  • MUNC18-1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
0.97
biological process
0.9
hub protein
0.85
kinase
0.85
disease perturbation
0.79


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 252.37   (req: < 5)
Gene RIFs: 53   (req: <= 3)
Antibodies: 456   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 252.37   (req: >= 5)
Gene RIFs: 53   (req: > 3)
Antibodies: 456   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 34
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (22)
Acetylcholine Neurotransmitter Release Cycle (R-HSA-264642)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 14
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Acetylcholine Neurotransmitter Release Cycle
Reactome
Dopamine Neurotransmitter Release Cycle
Reactome
GABA synthesis, release, reuptake and degradation
Reactome
Glutamate Neurotransmitter Release Cycle
Reactome
Integration of energy metabolism
Name
Explore in Pharos
Explore in Source
Acetylcholine Neurotransmitter Release Cycle
Dopamine Neurotransmitter Release Cycle
GABA synthesis, release, reuptake and degradation
Glutamate Neurotransmitter Release Cycle
Integration of energy metabolism
Gene Ontology Terms (50)
Items per page:
10
1 – 9 of 9
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (263)
1 – 10 of 263
STX11
Tbio
Novelty: 0.02724724
p_int: 0.999999995
p_ni: 5e-9
Score: 0.737
Data Source: BioPlex,STRINGDB
STX19
Tdark
Novelty: 3.68421053
p_int: 0.999984273
p_ni: 0.000015727
Score: 0.688
Data Source: BioPlex,STRINGDB
NUFIP1
Tbio
Novelty: 0.14861119
p_int: 0.999923903
p_ni: 0.000076097
p_wrong: 1e-9
Data Source: BioPlex
STX3
Tbio
Novelty: 0.01589793
p_int: 0.999779932
p_ni: 0.000220066
p_wrong: 3e-9
Score: 0.967
Data Source: BioPlex,STRINGDB
HAX1
Tbio
Novelty: 0.00851075
p_int: 0.999006016
p_ni: 0.000993921
p_wrong: 6.3e-8
Score: 0.152
Data Source: BioPlex,STRINGDB
TUSC3
Tbio
Novelty: 0.01081706
p_int: 0.998858739
p_ni: 0.001141242
p_wrong: 1.9e-8
Score: 0.225
Data Source: BioPlex,STRINGDB
DGUOK
Tbio
Family: Kinase
Novelty: 0.00695477
p_int: 0.998842758
p_ni: 0.001157242
Data Source: BioPlex
DNAAF2
Tbio
Novelty: 0.04657397
p_int: 0.998402141
p_ni: 0.001596737
p_wrong: 0.000001123
Data Source: BioPlex
ARMC1
Tbio
Novelty: 0.02013423
p_int: 0.99553724
p_ni: 0.00446276
Data Source: BioPlex
PHTF2
Tdark
Novelty: 2
p_int: 0.994634049
p_ni: 0.005365948
p_wrong: 2e-9
Data Source: BioPlex
Publication Statistics
PubMed Score  252.37

PubMed score by year
PubTator Score  152.9

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAPIGLKAVVGEKIMHDVIKKVKKKGEWKVLVVDQLSMRMLSSCCKMTDIMTEGITIVEDINKRREPLPS
1-70
LEAVYLITPSEKSVHSLISDFKDPPTAKYRAAHVFFTDSCPDALFNELVKSRAAKVIKTLTEINIAFLPY
70-140
ESQVYSLDSADSFQSFYSPHKAQMKNPILERLAEQIATLCATLKEYPAVRYRGEYKDNALLAQLIQDKLD
140-210
AYKADDPTMGEGPDKARSQLLILDRGFDPSSPVLHELTFQAMSYDLLPIENDVYKYETSGIGEARVKEVL
210-280
LDEDDDLWIALRHKHIAEVSQEVTRSLKDFSSSKRMNTGEKTTMRDLSQMLKKMPQYQKELSKYSTHLHL
280-350
AEDCMKHYQGTVDKLCRVEQDLAMGTDAEGEKIKDPMRAIVPILLDANVSTYDKIRIILLYIFLKNGITE
350-420
ENLNKLIQHAQIPPEDSEIITNMAHLGVPIVTDSTLRRRSKPERKERISEQTYQLSRWTPIIKDIMEDTI
420-490
EDKLDTKHYPYISTRSSASFSTTAVSARYGHWHKNKAPGEYRSGPRLIIFILGGVSLNEMRCAYEVTQAN
490-560
GKWEVLIGSTHILTPQKLLDTLKKLNKTDEEISS
560-594
MAPIGLKAVVGEKIMHDVIKKVKKKGEWKVLVVDQLSMRMLSSCCKMTDIMTEGITIVEDINKRREPLPSLEAVYLITPSEKSVHSLISDFKDPPTAKYRAAHVFFTDSCPDALFNELVKSRAAKVIKTLTEINIAFLPYESQVYSLDSADSFQSFYSPHKAQMKNPILERLAEQIATLCATLKEYPAVRYRGEYKDNALLAQLIQDKLDAYKADDPTMGEGPDKARSQLLILDRGFDPSSPVLHELTFQAMSYDLLPIENDVYKYETSGIGEARVKEVLLDEDDDLWIALRHKHIAEVSQEVTRSLKDFSSSKRMNTGEKTTMRDLSQMLKKMPQYQKELSKYSTHLHLAEDCMKHYQGTVDKLCRVEQDLAMGTDAEGEKIKDPMRAIVPILLDANVSTYDKIRIILLYIFLKNGITEENLNKLIQHAQIPPEDSEIITNMAHLGVPIVTDSTLRRRSKPERKERISEQTYQLSRWTPIIKDIMEDTIEDKLDTKHYPYISTRSSASFSTTAVSARYGHWHKNKAPGEYRSGPRLIIFILGGVSLNEMRCAYEVTQANGKWEVLIGSTHILTPQKLLDTLKKLNKTDEEISS