You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
POU3F4
POU domain, class 3, transcription factor 4

Protein Summary
Description
Probable transcription factor which exert its primary action widely during early neural development and in a very limited set of neurons in the mature brain. This gene encodes a member of the POU-III class of neural transcription factors. This family member plays a role in inner ear development. The protein is thought to be involved in the mediation of epigenetic signals which induce striatal neuron-precursor differentiation. Mutations in this gene are associated with X chromosome-linked nonsyndromic mixed deafness. [provided by RefSeq, Dec 2012]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000373200
  • ENSP00000362296
  • ENSG00000196767

Symbol
  • BRN4
  • OTF9
  • BRN4
  • DFN3
  • OTF9
  • BRN-4
  • DFNX2
  • OCT-9
  • OTF-9
  • BRAIN-4
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.92
biological process
0.59
gene perturbation
0.51
transcription factor
0.51
cell line
0.5


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 184.18   (req: < 5)
Gene RIFs: 25   (req: <= 3)
Antibodies: 87   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 184.18   (req: >= 5)
Gene RIFs: 25   (req: > 3)
Antibodies: 87   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (10)
Items per page:
10
1 – 4 of 4
GO Term
Evidence
Assigned by
Inferred from Sequence Alignment (ISA)
NTNU_SB
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (86)
1 – 10 of 86
DNAAF4
Tbio
Novelty: 0.02077895
Score: 0.715
Data Source: STRINGDB
SOX2
Tbio
Family: TF
Novelty: 0.00050367
Score: 0.704
Data Source: STRINGDB
NPAS1
Tbio
Family: TF
Novelty: 0.13050909
Score: 0.7
Data Source: STRINGDB
NPAS3
Tbio
Family: TF
Novelty: 0.03059697
Score: 0.687
Data Source: STRINGDB
MYO6
Tbio
Novelty: 0.01625694
Score: 0.677
Data Source: STRINGDB
DIAPH2
Tbio
Novelty: 0.01824434
Score: 0.621
Data Source: STRINGDB
GJB2
Tbio
Novelty: 0.00063266
Score: 0.602
Data Source: STRINGDB
IGF1
Tbio
Novelty: 0.00004544
Score: 0.601
Data Source: STRINGDB
KCNE5
Tbio
Novelty: 0.1013269
Score: 0.594
Data Source: STRINGDB
RAB40AL
Tbio
Novelty: 0.01280853
Score: 0.584
Data Source: STRINGDB
Publication Statistics
PubMed Score  184.18

PubMed score by year
PubTator Score  137.78

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MATAASNPYSILSSTSLVHADSAGMQQGSPFRNPQKLLQSDYLQGVPSNGHPLGHHWVTSLSDGGPWSST
1-70
LATSPLDQQDVKPGREDLQLGAIIHHRSPHVAHHSPHTNHPNAWGASPAPNPSITSSGQPLNVYSQPGFT
70-140
VSGMLEHGGLTPPPAAASAQSLHPVLREPPDHGELGSHHCQDHSDEETPTSDELEQFAKQFKQRRIKLGF
140-210
TQADVGLALGTLYGNVFSQTTICRFEGLQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRK
210-280
KRTSIEVSVKGVLETHFLKCPKPAAQEISSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGDQQPHEVYSH
280-350
TVKTDTSCHDL
350-361
MATAASNPYSILSSTSLVHADSAGMQQGSPFRNPQKLLQSDYLQGVPSNGHPLGHHWVTSLSDGGPWSSTLATSPLDQQDVKPGREDLQLGAIIHHRSPHVAHHSPHTNHPNAWGASPAPNPSITSSGQPLNVYSQPGFTVSGMLEHGGLTPPPAAASAQSLHPVLREPPDHGELGSHHCQDHSDEETPTSDELEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEGLQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGVLETHFLKCPKPAAQEISSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGDQQPHEVYSHTVKTDTSCHDL