You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
LCN2
Neutrophil gelatinase-associated lipocalin

Protein Classes
Protein Summary
Description
Iron-trafficking protein involved in multiple processes such as apoptosis, innate immunity and renal development (PubMed:12453413, PubMed:27780864, PubMed:20581821). Binds iron through association with 2,5-dihydroxybenzoic acid (2,5-DHBA), a siderophore that shares structural similarities with bacterial enterobactin, and delivers or removes iron from the cell, depending on the context. Iron-bound form (holo-24p3) is internalized following binding to the SLC22A17 (24p3R) receptor, leading to release of iron and subsequent increase of intracellular iron concentration. In contrast, association of the iron-free form (apo-24p3) with the SLC22A17 (24p3R) receptor is followed by association with an intracellular siderophore, iron chelation and iron transfer to the extracellular medium, thereby reducing intracellular iron concentration. Involved in apoptosis due to interleukin-3 (IL3) deprivation: iron-loaded form increases intracellular iron concentration without promoting apoptosis, while ir ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000277480
  • ENSP00000277480
  • ENSG00000148346
  • ENST00000373017
  • ENSP00000362108

Symbol
  • HNL
  • NGAL
  • p25
  • 24p3
  • MSFI
  • NGAL
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological term
1
gene perturbation
0.92
protein domain
0.85
biological process
0.78
small molecule perturbation
0.73


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2652.39   (req: < 5)
Gene RIFs: 599   (req: <= 3)
Antibodies: 1487   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2652.39   (req: >= 5)
Gene RIFs: 599   (req: > 3)
Antibodies: 1487   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 27
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (51)
1 – 5 of 51
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (13)
Antimicrobial peptides (R-HSA-6803157)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 10
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Antimicrobial peptides
Reactome
Cytokine Signaling in Immune system
Reactome
Immune System
Reactome
Innate Immune System
Reactome
Interleukin-4 and Interleukin-13 signaling
Name
Explore in Pharos
Explore in Source
Antimicrobial peptides
Cytokine Signaling in Immune system
Immune System
Innate Immune System
Interleukin-4 and Interleukin-13 signaling
Protein-Protein Interactions (209)
1 – 10 of 209
TBC1D22B
Tbio
Novelty: 6
p_int: 0.999989734
p_ni: 0.000010223
p_wrong: 4.3e-8
Data Source: BioPlex
DDX31
Tbio
Family: Enzyme
Novelty: 4
p_int: 0.999966637
p_ni: 0.00003292
p_wrong: 4.43e-7
Data Source: BioPlex
KIR3DS1
Tdark
p_int: 0.999928771
p_ni: 0.000071229
Data Source: BioPlex
TEFM
Tbio
Novelty: 0.13341034
p_int: 0.999919543
p_ni: 0.000080457
Data Source: BioPlex
PDE4DIP
Tbio
Novelty: 0.04181178
p_int: 0.999890552
p_ni: 0.000109448
Data Source: BioPlex
NPPA
Tchem
Novelty: 0.00054421
p_int: 0.999838423
p_ni: 0.00016157
p_wrong: 8e-9
Score: 0.174
Data Source: BioPlex,STRINGDB
SINHCAF
Tdark
Novelty: 0.25139665
p_int: 0.999828265
p_ni: 0.000171732
p_wrong: 3e-9
Data Source: BioPlex
ITGA9
Tbio
Novelty: 0.02771636
p_int: 0.999211206
p_ni: 0.0007887
p_wrong: 9.4e-8
Score: 0.194
Data Source: BioPlex,STRINGDB
KLHL11
Tdark
Novelty: 0.39728266
p_int: 0.997051145
p_ni: 0.002948854
p_wrong: 1e-9
Data Source: BioPlex
DDX19B
Tbio
Family: Enzyme
Novelty: 0.05099873
p_int: 0.99684281
p_ni: 0.003150986
p_wrong: 0.000006204
Data Source: BioPlex
Publication Statistics
PubMed Score  2652.39

PubMed score by year
PubTator Score  1797.09

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPLGLLWLGLALLGALHAQAQDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQK
1-70
MYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAM
70-140
VFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG
140-198
MPLGLLWLGLALLGALHAQAQDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG