You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
CCND3
G1/S-specific cyclin-D3

Protein Summary
Description
Regulatory component of the cyclin D3-CDK4 (DC) complex that phosphorylates and inhibits members of the retinoblastoma (RB) protein family including RB1 and regulates the cell-cycle during G(1)/S transition. Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complex and the subsequent transcription of E2F target genes which are responsible for the progression through the G(1) phase. Hypophosphorylates RB1 in early G(1) phase. Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals. Also substrate for SMAD3, phosphorylating SMAD3 in a cell-cycle-dependent manner and repressing its transcriptional activity. Component of the ternary complex, cyclin D3/CDK4/CDKN1B, required for nuclear translocation and activity of the cyclin D-CDK4 complex. The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the ce ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000372988
  • ENSP00000362079
  • ENSG00000112576
  • ENST00000372991
  • ENSP00000362082
  • ENST00000414200
  • ENSP00000397545
  • ENST00000415497
  • ENSP00000401595
  • ENST00000511642
  • ENSP00000426212
  • ENST00000616010
  • ENSP00000484424
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
trait
0.97
transcription factor perturbation
0.97
PubMedID
0.96
transcription factor binding site profile
0.93
chemical
0.91


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 319.87   (req: < 5)
Gene RIFs: 90   (req: <= 3)
Antibodies: 756   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 319.87   (req: >= 5)
Gene RIFs: 90   (req: > 3)
Antibodies: 756   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 16
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 1
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Active Ligands (1)
1 – 1 of 1
CHEMBL488436
chemical structure image
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (53)
Cell Cycle (R-HSA-1640170)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 15
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cell Cycle
Reactome
Cell Cycle, Mitotic
Reactome
Cyclin D associated events in G1
Reactome
Developmental Biology
Reactome
G1 Phase
Name
Explore in Pharos
Explore in Source
Cell Cycle
Cell Cycle, Mitotic
Cyclin D associated events in G1
Developmental Biology
G1 Phase
Protein-Protein Interactions (178)
1 – 10 of 178
CDK6
Tclin
Family: Kinase
Novelty: 0.00168972
p_int: 0.999999998
p_ni: 2e-9
Score: 0.999
Data Source: BioPlex,STRINGDB
CDKN1B
Tbio
Family: Enzyme
Novelty: 0.00079036
p_int: 0.999999932
p_ni: 6.8e-8
Score: 0.999
Data Source: BioPlex,STRINGDB
CDK4
Tclin
Family: Kinase
Novelty: 0.00051528
p_int: 0.999999792
p_ni: 2.08e-7
Score: 0.999
Data Source: BioPlex,STRINGDB
CDKN1C
Tbio
Family: Enzyme
Novelty: 0.00156129
p_int: 0.999999713
p_ni: 2.27e-7
p_wrong: 6e-8
Score: 0.991
Data Source: BioPlex,STRINGDB
RBL2
Tbio
Novelty: 0.00183781
p_int: 0.999995754
p_ni: 0.000004245
Score: 0.99
Data Source: BioPlex,STRINGDB
CDKN1A
Tbio
Family: Enzyme
Novelty: 0.00038005
p_int: 0.999956785
p_ni: 8.64e-7
p_wrong: 0.000042351
Score: 0.999
Data Source: BioPlex,STRINGDB
CDKN2C
Tbio
Family: Enzyme
Novelty: 0.01094308
p_int: 0.999916215
p_ni: 0.000072109
p_wrong: 0.000011676
Score: 0.991
Data Source: BioPlex,STRINGDB
KLK5
Tchem
Family: Enzyme
Novelty: 0.00957513
p_int: 0.999851267
p_ni: 0.00013718
p_wrong: 0.000011553
Data Source: BioPlex
CDK2
Tchem
Family: Kinase
Novelty: 0.00033882
p_int: 0.99931555
p_ni: 0.000684449
Score: 0.999
Data Source: BioPlex,STRINGDB
CDK5
Tchem
Family: Kinase
Novelty: 0.00081843
p_int: 0.996607531
p_ni: 0.003392469
Score: 0.696
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  319.87

PubMed score by year
PubTator Score  322.54

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKMLAYWMLEVCEE
1-70
QRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLTIEKLCIYTDHAVSPRQLRDW
70-140
EVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGA
140-210
AVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQ
210-280
TSTPTDVTAIHL
280-292
MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKMLAYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLTIEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL