Protein Classes
Protein Summary
Regulatory component of the cyclin D3-CDK4 (DC) complex that phosphorylates and inhibits members of the retinoblastoma (RB) protein family including RB1 and regulates the cell-cycle during G(1)/S transition. Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complex and the subsequent transcription of E2F target genes which are responsible for the progression through the G(1) phase. Hypophosphorylates RB1 in early G(1) phase. Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals. Also substrate for SMAD3, phosphorylating SMAD3 in a cell-cycle-dependent manner and repressing its transcriptional activity. Component of the ternary complex, cyclin D3/CDK4/CDKN1B, required for nuclear translocation and activity of the cyclin D-CDK4 complex. The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the ce ...more
- ENST00000372988
- ENSP00000362079
- ENSG00000112576
- ENST00000372991
- ENSP00000362082
- ENST00000414200
- ENSP00000397545
- ENST00000415497
- ENSP00000401595
- ENST00000511642
- ENSP00000426212
- ENST00000616010
- ENSP00000484424
Most Knowledge About | Knowledge Value
(0 to 1 scale) | ||
---|---|---|---|
trait | 0.97 | ||
transcription factor perturbation | 0.97 | ||
PubMedID | 0.96 | ||
transcription factor binding site profile | 0.93 | ||
chemical | 0.91 | ||
IDG Development Level Summary
These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 319.87 (req: < 5)
Gene RIFs: 90 (req: <= 3)
Antibodies: 756 (req: <= 50)
These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 319.87 (req: >= 5)
Gene RIFs: 90 (req: > 3)
Antibodies: 756 (req: > 50)
- OR - satisfy the following criterion:
Gene Ontology Terms: 16
Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions
Active Ligand: 1
Target has at least one approved drug - AND - satisfies the preceding conditions
Active Drug: 0
Active Ligands (1)
1 – 1 of 1
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id | Ligand | Method | Resolution (Ã…) | M.W. (kDa) | Pub Year | Title |
---|
PDB Structure Id | M.W. | Resolution | Pub Year |
---|
Pathways (53)
Reactome (15)
KEGG (15)
PathwayCommons (8)
WikiPathways (15)
Click on a row in the table to change the structure displayed.
Items per page:
1 – 5 of 15
Data Source | Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|---|
Reactome | Cell Cycle | ||||
Reactome | Cell Cycle, Mitotic | ||||
Reactome | Cyclin D associated events in G1 | ||||
Reactome | Developmental Biology | ||||
Reactome | G1 Phase | ||||
Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|
Cell Cycle | ||||
Cell Cycle, Mitotic | ||||
Cyclin D associated events in G1 | ||||
Developmental Biology | ||||
G1 Phase | ||||
Gene Ontology Terms (21)
Functions (3)
Components (5)
Processes (13)
Items per page:
10
1 – 3 of 3
GO Term | Evidence | Assigned by | ||
---|---|---|---|---|
Inferred from Physical Interaction (IPI) | BHF-UCL | |||
Inferred from Biological aspect of Ancestor (IBA) | GO_Central | |||
Inferred from Electronic Annotation (IEA) | Ensembl | |||
Protein-Protein Interactions (178)
1 – 10 of 178
CDK6
Family: Kinase
Novelty: 0.00168972
p_int: 0.999999998
p_ni: 2e-9
Score: 0.999
Data Source: BioPlex,STRINGDB
CDKN1B
Family: Enzyme
Novelty: 0.00079036
p_int: 0.999999932
p_ni: 6.8e-8
Score: 0.999
Data Source: BioPlex,STRINGDB
CDK4
Family: Kinase
Novelty: 0.00051528
p_int: 0.999999792
p_ni: 2.08e-7
Score: 0.999
Data Source: BioPlex,STRINGDB
CDKN1C
Family: Enzyme
Novelty: 0.00156129
p_int: 0.999999713
p_ni: 2.27e-7
p_wrong: 6e-8
Score: 0.991
Data Source: BioPlex,STRINGDB
RBL2
Novelty: 0.00183781
p_int: 0.999995754
p_ni: 0.000004245
Score: 0.99
Data Source: BioPlex,STRINGDB
CDKN1A
Family: Enzyme
Novelty: 0.00038005
p_int: 0.999956785
p_ni: 8.64e-7
p_wrong: 0.000042351
Score: 0.999
Data Source: BioPlex,STRINGDB
CDKN2C
Family: Enzyme
Novelty: 0.01094308
p_int: 0.999916215
p_ni: 0.000072109
p_wrong: 0.000011676
Score: 0.991
Data Source: BioPlex,STRINGDB
KLK5
Family: Enzyme
Novelty: 0.00957513
p_int: 0.999851267
p_ni: 0.00013718
p_wrong: 0.000011553
Data Source: BioPlex
CDK2
Family: Kinase
Novelty: 0.00033882
p_int: 0.99931555
p_ni: 0.000684449
Score: 0.999
Data Source: BioPlex,STRINGDB
CDK5
Family: Kinase
Novelty: 0.00081843
p_int: 0.996607531
p_ni: 0.003392469
Score: 0.696
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score 319.87
PubMed score by year
PubTator Score 322.54
PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKMLAYWMLEVCEE
1-70
QRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLTIEKLCIYTDHAVSPRQLRDW
70-140
EVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGA
140-210
AVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQ
210-280
TSTPTDVTAIHL
280-292
MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKMLAYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLTIEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL
Find similar targets by: