You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
CTSA
Lysosomal protective protein

Protein Summary
Description
Protective protein appears to be essential for both the activity of beta-galactosidase and neuraminidase, it associates with these enzymes and exerts a protective function necessary for their stability and activity. This protein is also a carboxypeptidase and can deamidate tachykinins. This gene encodes a member of the peptidase S10 family of serine carboxypeptidases. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate two chains that comprise the heterodimeric active enzyme. This enzyme possesses deamidase, esterase and carboxypeptidase activities and acts as a scaffold in the lysosomal multienzyme complex. Mutations in this gene are associated with galactosialidosis. [provided by RefSeq, Nov 2015]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000191018
  • ENSP00000191018
  • ENSG00000064601
  • ENST00000372459
  • ENSP00000361537
  • ENST00000646241
  • ENSP00000493613

Symbol
  • PPGB
  • GSL
  • GLB2
  • NGBE
  • PPCA
  • PPGB
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
1
interacting protein
0.98
transcription factor perturbation
0.94
disease perturbation
0.83
cellular component
0.8


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1122.2   (req: < 5)
Gene RIFs: 14   (req: <= 3)
Antibodies: 423   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1122.2   (req: >= 5)
Gene RIFs: 14   (req: > 3)
Antibodies: 423   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 12
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 402
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 2
Approved Drugs (2)
1 – 2 of 2
telaprevir
chemical structure image
boceprevir
chemical structure image
Protein Data Bank (11)
1 – 5 of 11
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (22)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 19
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Asparagine N-linked glycosylation
Reactome
Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein
Reactome
Defective NEU1 causes sialidosis
Reactome
Disease
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Asparagine N-linked glycosylation
Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein
Defective NEU1 causes sialidosis
Disease
Protein-Protein Interactions (223)
1 – 10 of 223
KLHDC9
Tbio
Novelty: 1.78217822
p_int: 0.993302053
p_ni: 0.006697947
Score: 0.357
Data Source: BioPlex,STRINGDB
PHF8
Tchem
Family: Epigenetic
Novelty: 0.0260773
p_int: 0.971659263
p_ni: 0.028340737
Data Source: BioPlex
SFXN5
Tdark
Novelty: 0.44295302
p_int: 0.953156301
p_ni: 0.046843699
Score: 0.188
Data Source: BioPlex,STRINGDB
C9orf40
Tdark
Novelty: 6
p_int: 0.946215996
p_ni: 0.053784004
Data Source: BioPlex
RHOA
Tbio
Family: Enzyme
Novelty: 0.0002729
p_int: 0.874201976
p_ni: 0.125798024
Score: 0.643
Data Source: BioPlex,STRINGDB
DNAJB2
Tbio
Novelty: 0.06294878
p_int: 0.85931443
p_ni: 0.140685568
p_wrong: 2e-9
Score: 0.255
Data Source: BioPlex,STRINGDB
RORC
Tchem
Family: NR
Novelty: 0.00579883
p_int: 0.804071954
p_ni: 0.195928045
p_wrong: 1e-9
Score: 0.368
Data Source: BioPlex,STRINGDB
RHOC
Tbio
Family: Enzyme
Novelty: 0.00407673
p_int: 0.775450041
p_ni: 0.224549959
Score: 0.809
Data Source: BioPlex,STRINGDB
GLB1
Tchem
Family: Enzyme
Novelty: 0.00274332
Score: 0.993
Data Source: Reactome,STRINGDB
NEU1
Tbio
Family: Enzyme
Novelty: 0.00564304
Score: 0.987
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  1122.20

PubMed score by year
PubTator Score  365.65

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MIRAAPPPLFLLLLLLLLLVSWASRGEAAPDQDEIQRLPGLAKQPSFRQYSGYLKGSGSKHLHYWFVESQ
1-70
KDPENSPVVLWLNGGPGCSSLDGLLTEHGPFLVQPDGVTLEYNPYSWNLIANVLYLESPAGVGFSYSDDK
70-140
FYATNDTEVAQSNFEALQDFFRLFPEYKNNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLSS
140-210
YEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCSQNKCNFYDNKDLECVTNLQEVARIVGNSGLNIYNLYAP
210-280
CAGGVPSHFRYEKDTVVVQDLGNIFTRLPLKRMWHQALLRSGDKVRMDPPCTNTTAASTYLNNPYVRKAL
280-350
NIPEQLPQWDMCNFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKME
350-420
VQRRPWLVKYGDSGEQIAGFVKEFSHIAFLTIKGAGHMVPTDKPLAAFTMFSRFLNKQPY
420-480
MIRAAPPPLFLLLLLLLLLVSWASRGEAAPDQDEIQRLPGLAKQPSFRQYSGYLKGSGSKHLHYWFVESQKDPENSPVVLWLNGGPGCSSLDGLLTEHGPFLVQPDGVTLEYNPYSWNLIANVLYLESPAGVGFSYSDDKFYATNDTEVAQSNFEALQDFFRLFPEYKNNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCSQNKCNFYDNKDLECVTNLQEVARIVGNSGLNIYNLYAPCAGGVPSHFRYEKDTVVVQDLGNIFTRLPLKRMWHQALLRSGDKVRMDPPCTNTTAASTYLNNPYVRKALNIPEQLPQWDMCNFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVKYGDSGEQIAGFVKEFSHIAFLTIKGAGHMVPTDKPLAAFTMFSRFLNKQPY