You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ASS1
Argininosuccinate synthase

Protein Classes
Protein Summary
Description
One of the enzymes of the urea cycle, the metabolic pathway transforming neurotoxic amonia produced by protein catabolism into inocuous urea in the liver of ureotelic animals. Catalyzes the formation of arginosuccinate from aspartate, citrulline and ATP and together with ASL it is responsible for the biosynthesis of arginine in most body tissues. The protein encoded by this gene catalyzes the penultimate step of the arginine biosynthetic pathway. There are approximately 10 to 14 copies of this gene including the pseudogenes scattered across the human genome, among which the one located on chromosome 9 appears to be the only functional gene for argininosuccinate synthetase. Mutations in the chromosome 9 copy of this gene cause citrullinemia. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Aug 2012]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000352480
  • ENSP00000253004
  • ENSG00000130707
  • ENST00000372393
  • ENSP00000361469
  • ENST00000372394
  • ENSP00000361471

Symbol
  • ASS
  • ASS
  • CTLN1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.98
biological process
0.97
transcription factor perturbation
0.97
molecular function
0.96
PubMedID
0.93


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 208.06   (req: < 5)
Gene RIFs: 58   (req: <= 3)
Antibodies: 416   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 208.06   (req: >= 5)
Gene RIFs: 58   (req: > 3)
Antibodies: 416   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 36
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (22)
Metabolism (R-HSA-1430728)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism
Reactome
Metabolism of amino acids and derivatives
Reactome
Urea cycle
Name
Explore in Pharos
Explore in Source
Metabolism
Metabolism of amino acids and derivatives
Urea cycle
Gene Ontology Terms (46)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
IntAct
Inferred from Mutant Phenotype (IMP)
BHF-UCL
Inferred from Mutant Phenotype (IMP)
UniProtKB
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (188)
1 – 10 of 188
PC
Tbio
Family: Enzyme
Novelty: 0.00322567
p_int: 0.999515706
p_ni: 0.000484294
Score: 0.66
Data Source: BioPlex,STRINGDB
CA10
Tbio
Family: Enzyme
Novelty: 0.00219785
p_int: 0.998622124
p_ni: 0.001377876
Score: 0.207
Data Source: BioPlex,STRINGDB
TMEM184A
Tbio
Novelty: 0.18808777
p_int: 0.997725303
p_ni: 0.002274697
Score: 0.165
Data Source: BioPlex,STRINGDB
MPC1
Tbio
Novelty: 0.01329808
p_int: 0.985499765
p_ni: 0.014500235
Data Source: BioPlex
SIRT3
Tchem
Family: Epigenetic
Novelty: 0.00132584
p_int: 0.931149838
p_ni: 0.068850162
Score: 0.222
Data Source: BioPlex,STRINGDB
ZNF354C
Tdark
Family: TF
Novelty: 0.17595308
p_int: 0.793796255
p_ni: 0.206203745
Score: 0.187
Data Source: BioPlex,STRINGDB
ASL
Tbio
Family: Enzyme
Novelty: 0.00771154
Score: 0.999
Data Source: STRINGDB
OTC
Tchem
Family: Enzyme
Novelty: 0.00714501
Score: 0.999
Data Source: STRINGDB
CPS1
Tclin
Family: Enzyme
Novelty: 0.00406897
Score: 0.995
Data Source: STRINGDB
ASNS
Tchem
Family: Enzyme
Novelty: 0.00372649
Score: 0.993
Data Source: STRINGDB
Publication Statistics
PubMed Score  208.06

PubMed score by year
PubTator Score  153.69

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSSKGSVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVFIEDVSREFVE
1-70
EFIWPAIQSSALYEDRYLLGTSLARPCIARKQVEIAQREGAKYVSHGATGKGNDQVRFELSCYSLAPQIK
70-140
VIAPWRMPEFYNRFKGRNDLMEYAKQHGIPIPVTPKNPWSMDENLMHISYEAGILENPKNQAPPGLYTKT
140-210
QDPAKAPNTPDILEIEFKKGVPVKVTNVKDGTTHQTSLELFMYLNEVAGKHGVGRIDIVENRFIGMKSRG
210-280
IYETPAGTILYHAHLDIEAFTMDREVRKIKQGLGLKFAELVYTGFWHSPECEFVRHCIAKSQERVEGKVQ
280-350
VSVLKGQVYILGRESPLSLYNEELVSMNVQGDYEPTDATGFININSLRLKEYHRLQSKVTAK
350-412
MSSKGSVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVFIEDVSREFVEEFIWPAIQSSALYEDRYLLGTSLARPCIARKQVEIAQREGAKYVSHGATGKGNDQVRFELSCYSLAPQIKVIAPWRMPEFYNRFKGRNDLMEYAKQHGIPIPVTPKNPWSMDENLMHISYEAGILENPKNQAPPGLYTKTQDPAKAPNTPDILEIEFKKGVPVKVTNVKDGTTHQTSLELFMYLNEVAGKHGVGRIDIVENRFIGMKSRGIYETPAGTILYHAHLDIEAFTMDREVRKIKQGLGLKFAELVYTGFWHSPECEFVRHCIAKSQERVEGKVQVSVLKGQVYILGRESPLSLYNEELVSMNVQGDYEPTDATGFININSLRLKEYHRLQSKVTAK