You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
ABL1
Tyrosine-protein kinase ABL1

Protein Summary
Description
Non-receptor tyrosine-protein kinase that plays a role in many key processes linked to cell growth and survival such as cytoskeleton remodeling in response to extracellular stimuli, cell motility and adhesion, receptor endocytosis, autophagy, DNA damage response and apoptosis. Coordinates actin remodeling through tyrosine phosphorylation of proteins controlling cytoskeleton dynamics like WASF3 (involved in branch formation); ANXA1 (involved in membrane anchoring); DBN1, DBNL, CTTN, RAPH1 and ENAH (involved in signaling); or MAPT and PXN (microtubule-binding proteins). Phosphorylation of WASF3 is critical for the stimulation of lamellipodia formation and cell migration. Involved in the regulation of cell adhesion and motility through phosphorylation of key regulators of these processes such as BCAR1, CRK, CRKL, DOK1, EFS or NEDD9. Phosphorylates multiple receptor tyrosine kinases and more particularly promotes endocytosis of EGFR, facilitates the formation of neuromuscular synapses thro ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000318560
  • ENSP00000323315
  • ENSG00000097007
  • ENST00000372348
  • ENSP00000361423

Symbol
  • ABL
  • JTK7
  • ABL
  • JTK7
  • p150
  • c-ABL
  • v-abl
  • CHDSKM
  • c-ABL1
  • bcr/abl
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
biological term
1
chemical bioactivity profile
1
hub protein
1
kinase
1


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3627.02   (req: < 5)
Gene RIFs: 482   (req: <= 3)
Antibodies: 2041   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3627.02   (req: >= 5)
Gene RIFs: 482   (req: > 3)
Antibodies: 2041   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 120
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 987
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 10
Protein Data Bank (63)
1 – 5 of 63
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (82)
Axon guidance (R-HSA-422475)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 35
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Axon guidance
Reactome
Cell Cycle
Reactome
Cell Cycle, Mitotic
Reactome
Cyclin D associated events in G1
Reactome
DNA Double Strand Break Response
Name
Explore in Pharos
Explore in Source
Axon guidance
Cell Cycle
Cell Cycle, Mitotic
Cyclin D associated events in G1
DNA Double Strand Break Response
Gene Ontology Terms (135)
Items per page:
10
1 – 10 of 21
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
MGI
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Physical Interaction (IPI)
CAFA
Protein-Protein Interactions (459)
1 – 10 of 459
ABI2
Tbio
Novelty: 0.03279246
p_int: 0.846653982
p_ni: 6e-9
p_wrong: 0.153346013
Score: 0.998
Data Source: BioPlex,STRINGDB
RIN1
Tbio
Novelty: 0.02228321
p_int: 0.80855585
p_ni: 5e-9
p_wrong: 0.191444145
Score: 0.984
Data Source: BioPlex,STRINGDB
ABI1
Tbio
Novelty: 0.00801126
Score: 0.997
Data Source: STRINGDB
CRK
Tbio
Novelty: 0.00270563
Score: 0.996
Data Source: STRINGDB
TP73
Tbio
Family: TF
Novelty: 0.00899658
Score: 0.99
Data Source: STRINGDB
ATM
Tchem
Family: Kinase
Novelty: 0.00023967
Score: 0.988
Data Source: Reactome,STRINGDB
RAD51
Tchem
Novelty: 0.00014377
Score: 0.987
Data Source: STRINGDB
MDM2
Tchem
Family: Enzyme
Novelty: 0.00036068
Score: 0.982
Data Source: STRINGDB
YAP1
Tbio
Novelty: 0.00177068
Score: 0.982
Data Source: Reactome,STRINGDB
CTNNB1
Tchem
Novelty: 0.00008951
Score: 0.98
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  3627.02

PubMed score by year
PubTator Score  5494.32

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MLEICLKLVGCKSKKGLSSSSSCYLEEALQRPVASDFEPQGLSEAARWNSKENLLAGPSENDPNLFVALY
1-70
DFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYL
70-140
LSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLI
140-210
TTLHYPAPKRNKPTVYGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEV
210-280
EEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSA
280-350
MEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKS
350-420
DVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIH
420-490
QAFETMFQESSISDEVEKELGKQGVRGAVSTLLQAPELPTKTRTSRRAAEHRDTTDVPEMPHSKGQGESD
490-560
PLDHEPAVSPLLPRKERGPPEGGLNEDERLLPKDKKTNLFSALIKKKKKTAPTPPKRSSSFREMDGQPER
560-630
RGAGEEEGRDISNGALAFTPLDTADPAKSPKPSNGAGVPNGALRESGGSGFRSPHLWKKSSTLTSSRLAT
630-700
GEEEGGGSSSKRFLRSCSASCVPHGAKDTEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPALPRKRAGEN
700-770
RSDQVTRGTVTPPPRLVKKNEEAADEVFKDIMESSPGSSPPNLTPKPLRRQVTVAPASGLPHKEEAGKGS
770-840
ALGTPAAAEPVTPTSKAGSGAPGGTSKGPAEESRVRRHKHSSESPGRDKGKLSRLKPAPPPPPAASAGKA
840-910
GGKPSQSPSQEAAGEAVLGAKTKATSLVDAVNSDAAKPSQPGEGLKKPVLPATPKPQSAKPSGTPISPAP
910-980
VPSTLPSASSALAGDQPSSTAFIPLISTRVSLRKTRQPPERIASGAITKGVVLDSTEALCLAISRNSEQM
980-1050
ASHSAVLEAGKNLYTFCVSYVDSIQQMRNKFAFREAINKLENNLRELQICPATAGSGPAATQDFSKLLSS
1050-1120
VKEISDIVQR
1120-1130
MLEICLKLVGCKSKKGLSSSSSCYLEEALQRPVASDFEPQGLSEAARWNSKENLLAGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTVYGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGKQGVRGAVSTLLQAPELPTKTRTSRRAAEHRDTTDVPEMPHSKGQGESDPLDHEPAVSPLLPRKERGPPEGGLNEDERLLPKDKKTNLFSALIKKKKKTAPTPPKRSSSFREMDGQPERRGAGEEEGRDISNGALAFTPLDTADPAKSPKPSNGAGVPNGALRESGGSGFRSPHLWKKSSTLTSSRLATGEEEGGGSSSKRFLRSCSASCVPHGAKDTEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPALPRKRAGENRSDQVTRGTVTPPPRLVKKNEEAADEVFKDIMESSPGSSPPNLTPKPLRRQVTVAPASGLPHKEEAGKGSALGTPAAAEPVTPTSKAGSGAPGGTSKGPAEESRVRRHKHSSESPGRDKGKLSRLKPAPPPPPAASAGKAGGKPSQSPSQEAAGEAVLGAKTKATSLVDAVNSDAAKPSQPGEGLKKPVLPATPKPQSAKPSGTPISPAPVPSTLPSASSALAGDQPSSTAFIPLISTRVSLRKTRQPPERIASGAITKGVVLDSTEALCLAISRNSEQMASHSAVLEAGKNLYTFCVSYVDSIQQMRNKFAFREAINKLENNLRELQICPATAGSGPAATQDFSKLLSSVKEISDIVQR