You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CARD9
Caspase recruitment domain-containing protein 9

Protein Summary
Description
Adapter protein that plays a key role in innate immune response to a number of intracellular pathogens, such as C.albicans and L.monocytogenes. Is at the crossroads of ITAM-tyrosine kinase and the Toll-like receptors (TLR) and NOD2 signaling pathways. Probably controls various innate immune response pathways depending on the intracellular pathogen. In response to L.monocytogenes infection, acts by connecting NOD2 recognition of peptidoglycan to downstream activation of MAP kinases (MAPK) without activating NF-kappa-B. Also involved in activation of myeloid cells via classical ITAM-associated receptors and TLR: required for TLR-mediated activation of MAPK, while it is not required for TLR-induced activation of NF-kappa-B (By similarity). Controls CLEC7A (dectin-1)-mediated myeloid cell activation induced by the yeast cell wall component zymosan, leading to cytokine production and innate anti-fungal immunity: acts by regulating BCL10-MALT1-mediated NF-kappa-B activation pathway. Activate ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000371732
  • ENSP00000360797
  • ENSG00000187796
  • ENST00000371734
  • ENSP00000360799
  • ENST00000489932
  • ENSP00000451368

Symbol
  • CANDF2
  • hCARD9
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.79
tissue sample
0.7
interacting protein
0.62
tissue
0.62
gene perturbation
0.56


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 123.73   (req: < 5)
Gene RIFs: 42   (req: <= 3)
Antibodies: 243   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 123.73   (req: >= 5)
Gene RIFs: 42   (req: > 3)
Antibodies: 243   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 20
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (4)
1 – 4 of 4
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (11)
C-type lectin receptors (CLRs) (R-HSA-5621481)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
C-type lectin receptors (CLRs)
Reactome
CLEC7A (Dectin-1) signaling
Reactome
Immune System
Reactome
Innate Immune System
Reactome
NOD1/2 Signaling Pathway
Name
Explore in Pharos
Explore in Source
C-type lectin receptors (CLRs)
CLEC7A (Dectin-1) signaling
Immune System
Innate Immune System
NOD1/2 Signaling Pathway
Gene Ontology Terms (23)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Protein-Protein Interactions (92)
1 – 10 of 92
PHETA1
Tbio
Novelty: 0.80645161
p_int: 0.999999357
p_ni: 6.43e-7
Score: 0.251
Data Source: BioPlex,STRINGDB
GSTT2B
Tbio
Family: Enzyme
Novelty: 0.02896495
p_int: 0.999954629
p_ni: 0.000045345
p_wrong: 2.6e-8
Score: 0.807
Data Source: BioPlex,STRINGDB
CEP135
Tbio
Novelty: 0.05545197
p_int: 0.999942036
p_ni: 0.000057948
p_wrong: 1.6e-8
Score: 0.534
Data Source: BioPlex,STRINGDB
ENOPH1
Tbio
Family: Enzyme
Novelty: 0.10518475
p_int: 0.999906185
p_ni: 0.000093814
p_wrong: 1e-9
Score: 0.825
Data Source: BioPlex,STRINGDB
NFRKB
Tbio
Novelty: 0.16363636
p_int: 0.998427847
p_ni: 0.001572153
Score: 0.211
Data Source: BioPlex,STRINGDB
THEM4
Tbio
Family: Enzyme
Novelty: 0.00511448
p_int: 0.977120834
p_ni: 0.022874529
p_wrong: 0.000004637
Score: 0.679
Data Source: BioPlex,STRINGDB
CDK5RAP2
Tbio
Novelty: 0.01336212
p_int: 0.961166895
p_ni: 0.038833105
Score: 0.209
Data Source: BioPlex,STRINGDB
EDC3
Tbio
Novelty: 0.03405228
p_int: 0.892832073
p_ni: 0.107167927
Score: 0.228
Data Source: BioPlex,STRINGDB
BCL10
Tbio
Novelty: 0.00196153
Score: 0.992
Data Source: Reactome,STRINGDB
NOD1
Tchem
Novelty: 0.00337321
Score: 0.972
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  123.73

PubMed score by year
PubTator Score  78.58

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSDYENDDECWSVLEGFRVTLTSVIDPSRITPYLRQCKVLNPDDEEQVLSDPNLVIRKRKVGVLLDILQR
1-70
TGHKGYVAFLESLELYYPQLYKKVTGKEPARVFSMIIDASGESGLTQLLMTEVMKLQKKVQDLTALLSSK
70-140
DDFIKELRVKDSLLRKHQERVQRLKEECEAGSRELKRCKEENYDLAMRLAHQSEEKGAALMRNRDLQLEI
140-210
DQLKHSLMKAEDDCKVERKHTLKLRHAMEQRPSQELLWELQQEKALLQARVQELEASVQEGKLDRSSPYI
210-280
QVLEEDWRQALRDHQEQANTIFSLRKDLRQGEARRLRCMEEKEMFELQCLALRKDSKMYKDRIEAILLQM
280-350
EEVAIERDQAIATREELHAQHARGLQEKDALRKQVRELGEKADELQLQVFQCEAQLLAVEGRLRRQQLET
350-420
LVLSSDLEDGSPRRSQELSLPQDLEDTQLSDKGCLAGGGSPKQPFAALHQEQVLRNPHDAGLSSGEPPEK
420-490
ERRRLKESFENYRRKRALRKMQKGWRQGEEDRENTTGSDNTDTEGS
490-536
MSDYENDDECWSVLEGFRVTLTSVIDPSRITPYLRQCKVLNPDDEEQVLSDPNLVIRKRKVGVLLDILQRTGHKGYVAFLESLELYYPQLYKKVTGKEPARVFSMIIDASGESGLTQLLMTEVMKLQKKVQDLTALLSSKDDFIKELRVKDSLLRKHQERVQRLKEECEAGSRELKRCKEENYDLAMRLAHQSEEKGAALMRNRDLQLEIDQLKHSLMKAEDDCKVERKHTLKLRHAMEQRPSQELLWELQQEKALLQARVQELEASVQEGKLDRSSPYIQVLEEDWRQALRDHQEQANTIFSLRKDLRQGEARRLRCMEEKEMFELQCLALRKDSKMYKDRIEAILLQMEEVAIERDQAIATREELHAQHARGLQEKDALRKQVRELGEKADELQLQVFQCEAQLLAVEGRLRRQQLETLVLSSDLEDGSPRRSQELSLPQDLEDTQLSDKGCLAGGGSPKQPFAALHQEQVLRNPHDAGLSSGEPPEKERRRLKESFENYRRKRALRKMQKGWRQGEEDRENTTGSDNTDTEGS