You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
RUNX2
Runt-related transcription factor 2

Protein Summary
Description
Transcription factor involved in osteoblastic differentiation and skeletal morphogenesis (PubMed:28505335, PubMed:28738062, PubMed:28703881). Essential for the maturation of osteoblasts and both intramembranous and endochondral ossification. CBF binds to the core site, 5'-PYGPYGGT-3', of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, osteocalcin, osteopontin, bone sialoprotein, alpha 1(I) collagen, LCK, IL-3 and GM-CSF promoters. In osteoblasts, supports transcription activation: synergizes with SPEN/MINT to enhance FGFR2-mediated activation of the osteocalcin FGF-responsive element (OCFRE) (By similarity). Inhibits KAT6B-dependent transcriptional activation. This gene is a member of the RUNX family of transcription factors and encodes a nuclear protein with an Runt DNA-binding domain. This protein is essential for osteoblastic differentiation and skeletal morphogenesis and acts as a scaffold for nucleic acids and ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000359524
  • ENSP00000352514
  • ENSG00000124813
  • ENST00000371432
  • ENSP00000360486
  • ENST00000371436
  • ENSP00000360491
  • ENST00000371438
  • ENSP00000360493
  • ENST00000465038
  • ENSP00000420707
  • ENST00000647337
  • ENSP00000495497

Symbol
  • AML3
  • CBFA1
  • OSF2
  • PEBP2A
  • CCD
  • AML3
  • CCD1
  • CLCD
  • OSF2
  • CBFA1
  • OSF-2
  • PEA2aA
  • PEBP2aA
  • CBF-alpha-1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
1
biological process
0.98
co-expressed gene
0.96
biological term
0.94
protein domain
0.92


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2735.08   (req: < 5)
Gene RIFs: 396   (req: <= 3)
Antibodies: 810   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2735.08   (req: >= 5)
Gene RIFs: 396   (req: > 3)
Antibodies: 810   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 36
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (33)
Gene expression (Transcription) (R-HSA-74160)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 13
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Gene expression (Transcription)
Reactome
Generic Transcription Pathway
Reactome
RNA Polymerase II Transcription
Reactome
RUNX1 regulates transcription of genes involved in differentiation of myeloid cells
Reactome
RUNX2 regulates bone development
Name
Explore in Pharos
Explore in Source
Gene expression (Transcription)
Generic Transcription Pathway
RNA Polymerase II Transcription
RUNX1 regulates transcription of genes involved in differentiation of myeloid cells
RUNX2 regulates bone development
Gene Ontology Terms (41)
Items per page:
10
1 – 9 of 9
GO Term
Evidence
Assigned by
Inferred from Sequence Alignment (ISA)
NTNU_SB
Non-traceable Author Statement (NAS)
ProtInc
Inferred from Electronic Annotation (IEA)
InterPro
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (384)
1 – 10 of 384
CBFB
Tchem
Family: TF
Novelty: 0.08455808
p_int: 0.99999983
p_ni: 6e-9
p_wrong: 1.64e-7
Score: 0.948
Data Source: BioPlex,Reactome,STRINGDB
SMAD3
Tbio
Family: TF
Novelty: 0.00058288
Score: 0.985
Data Source: STRINGDB
MAPK1
Tchem
Family: Kinase
Novelty: 0.00046573
Score: 0.972
Data Source: Reactome,STRINGDB
BGLAP
Tbio
Novelty: 0.00011426
Score: 0.971
Data Source: STRINGDB
SP7
Tbio
Family: TF
Novelty: 0.00141584
Score: 0.967
Data Source: Reactome,STRINGDB
BMP2
Tbio
Novelty: 0.00020018
Score: 0.965
Data Source: STRINGDB
SOX9
Tbio
Family: TF
Novelty: 0.00058844
Score: 0.964
Data Source: Reactome,STRINGDB
SMAD4
Tbio
Family: TF
Novelty: 0.00064135
Score: 0.961
Data Source: Reactome,STRINGDB
MAPK3
Tchem
Family: Kinase
Novelty: 0.0001911
Score: 0.957
Data Source: Reactome,STRINGDB
RB1
Tchem
Novelty: 0.00084849
Score: 0.956
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  2735.08

PubMed score by year
PubTator Score  1579.04

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MASNSLFSTVTPCQQNFFWDPSTSRRFSPPSSSLQPGKMSDVSPVVAAQQQQQQQQQQQQQQQQQQQQQQ
1-70
QEAAAAAAAAAAAAAAAAAVPRLRPPHDNRTMVEIIADHPAELVRTDSPNFLCSVLPSHWRCNKTLPVAF
70-140
KVVALGEVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQV
140-210
ATYHRAIKVTVDGPREPRRHRQKLDDSKPSLFSDRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFNPQ
210-280
GQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFC
280-350
LWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRMHYPATFTYTPPVTSGMSLGMSATTHYHT
350-420
YLPPPYPGSSQSQSGPFQTSSTPYLYYGTSSGSYQFPMVPGGDRSPSRMLPPCTTTSNGSTLLNPNLPNQ
420-490
NDGVDADGSHSSSPTVLNSSGRMDESVWRPY
490-521
MASNSLFSTVTPCQQNFFWDPSTSRRFSPPSSSLQPGKMSDVSPVVAAQQQQQQQQQQQQQQQQQQQQQQQEAAAAAAAAAAAAAAAAAVPRLRPPHDNRTMVEIIADHPAELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGEVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKVTVDGPREPRRHRQKLDDSKPSLFSDRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRMHYPATFTYTPPVTSGMSLGMSATTHYHTYLPPPYPGSSQSQSGPFQTSSTPYLYYGTSSGSYQFPMVPGGDRSPSRMLPPCTTTSNGSTLLNPNLPNQNDGVDADGSHSSSPTVLNSSGRMDESVWRPY