You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SORBS1
Sorbin and SH3 domain-containing protein 1

Protein Summary
Description
Plays a role in tyrosine phosphorylation of CBL by linking CBL to the insulin receptor. Required for insulin-stimulated glucose transport. Involved in formation of actin stress fibers and focal adhesions (By similarity). This gene encodes a CBL-associated protein which functions in the signaling and stimulation of insulin. Mutations in this gene may be associated with human disorders of insulin resistance. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2014]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000277982
  • ENSP00000277982
  • ENSG00000095637
  • ENST00000306402
  • ENSP00000302556
  • ENST00000354106
  • ENSP00000277984
  • ENST00000361941
  • ENSP00000355136
  • ENST00000371227
  • ENSP00000360271
  • ENST00000371239
  • ENSP00000360283
  • ENST00000371241
  • ENSP00000360285
  • ENST00000371245
  • ENSP00000360291
  • ENST00000371246
  • ENSP00000360292
  • ENST00000371247
  • ENSP00000360293
  • ENST00000371249
  • ENSP00000360295
  • ENST00000607232
  • ENSP00000475901

Symbol
  • KIAA0894
  • KIAA1296
  • SH3D5
  • CAP
  • FLAF2
  • R85FL
  • SH3D5
  • SORB1
  • SH3P12
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
PubMedID
0.97
transcription factor
0.91
biological process
0.88
kinase perturbation
0.84
transcription factor perturbation
0.84


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 50.5   (req: < 5)
Gene RIFs: 22   (req: <= 3)
Antibodies: 249   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 50.5   (req: >= 5)
Gene RIFs: 22   (req: > 3)
Antibodies: 249   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 15
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (11)
1 – 5 of 11
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (21)
Muscle contraction (R-HSA-397014)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 2 of 2
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Muscle contraction
Reactome
Smooth Muscle Contraction
Name
Explore in Pharos
Explore in Source
Muscle contraction
Smooth Muscle Contraction
Protein-Protein Interactions (165)
1 – 10 of 165
VCL
Tbio
Novelty: 0.00044707
Score: 0.987
Data Source: STRINGDB
CBL
Tbio
Family: Enzyme
Novelty: 0.00118988
Score: 0.974
Data Source: STRINGDB
INSR
Tclin
Family: Kinase
Novelty: 0.0029743
Score: 0.969
Data Source: STRINGDB
PXN
Tbio
Novelty: 0.00103853
Score: 0.962
Data Source: STRINGDB
AFDN
Tbio
Novelty: 0.00626505
Score: 0.96
Data Source: STRINGDB
SH2B2
Tbio
Novelty: 0.326382
Score: 0.955
Data Source: STRINGDB
RAPGEF1
Tbio
Novelty: 0.00343756
Score: 0.946
Data Source: STRINGDB
INS
Tbio
Novelty: 0.00000614
Score: 0.939
Data Source: STRINGDB
ITGA1
Tbio
Novelty: 0.00994526
Score: 0.931
Data Source: STRINGDB
CRK
Tbio
Novelty: 0.00270563
Score: 0.928
Data Source: STRINGDB
Publication Statistics
PubMed Score  50.50

PubMed score by year
PubTator Score  27.25

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSSECDGGSKAVMNGLAPGSNGQDKATADPLRARSISAVKIIPVKTVKNASGLVLPTDMDLTKICTGKGA
1-70
VTLRASSSYRETPSSSPASPQETRQHESKPGLEPEPSSADEWRLSSSADANGNAQPSSLAAKGYRSVHPN
70-140
LPSDKSQDATSSSAAQPEVIVVPLYLVNTDRGQEGTARPPTPLGPLGCVPTIPATASAASPLTFPTLDDF
140-210
IPPHLQRWPHHSQPARASGSFAPISQTPPSFSPPPPLVPPAPEDLRRVSEPDLTGAVSSTDSSPLLNEVS
210-280
SSLIGTDSQAFPSVSKPSSAYPSTTIVNPTIVLLQHNREQQKRLSSLSDPVSERRVGEQDSAPTQEKPTS
280-350
PGKAIEKRAKDDSRRVVKSTQDLSDVSMDEVGIPLRNTERSKDWYKTMFKQIHKLNRDTPEENPYFPTYK
350-420
FPELPEIQQTSEEDNPYTPTYQFPASTPSPKSEDDDSDLYSPRYSFSEDTKSPLSVPRSKSEMSYIDGEK
420-490
VVKRSATLPLPARSSSLKSSSERNDWEPPDKKVDTRKYRAEPKSIYEYQPGKSSVLTNEKMSRDISPEEI
490-560
DLKNEPWYKFFSELEFGKPPPKKIWDYTPGDCSILPREDRKTNLDKDLSLCQTELEADLEKMETLNKAPS
560-630
ANVPQSSAISPTPEISSETPGYIYSSNFHAVKRESDGAPGDLTSLENERQIYKSVLEGGDIPLQGLSGLK
630-700
RPSSSASTKDSESPRHFIPADYLESTEEFIRRRHDDKEKLLADQRRLKREQEEADIAARRHTGVIPTHHQ
700-770
FITNERFGDLLNIDDTAKRKSGSEMRPARAKFDFKAQTLKELPLQKGDIVYIYKQIDQNWYEGEHHGRVG
770-840
IFPRTYIELLPPAEKAQPKKLTPVQVLEYGEAIAKFNFNGDTQVEMSFRKGERITLLRQVDENWYEGRIP
840-910
GTSRQGIFPITYVDVIKRPLVKNPVDYMDLPFSSSPSRSATASPQFSSHSKLITPAPSSLPHSRRALSPE
910-980
MHAVTSEWISLTVGVPGRRSLALTPPLPPLPEASIYNTDHLALSPRASPSLSLSLPHLSWSDRPTPRSVA
980-1050
SPLALPSPHKTYSLAPTSQASLHMNGDGGVHTPSSGIHQDSFLQLPLGSSDSVISQLSDAFSSQSKRQPW
1050-1120
REESGQYERKAERGAGERGPGGPKISKKSCLKPSDVVRCLSTEQRLSDLNTPEESRPGKPLGSAFPGSEA
1120-1190
EQTERHRGGEQAGRKAARRGGSQQPQAQQRRVTPDRSQTSQDLFSYQALYSYIPQNDDELELRDGDIVDV
1190-1260
MEKCDDGWFVGTSRRTKQFGTFPGNYVKPLYL
1260-1292
MSSECDGGSKAVMNGLAPGSNGQDKATADPLRARSISAVKIIPVKTVKNASGLVLPTDMDLTKICTGKGAVTLRASSSYRETPSSSPASPQETRQHESKPGLEPEPSSADEWRLSSSADANGNAQPSSLAAKGYRSVHPNLPSDKSQDATSSSAAQPEVIVVPLYLVNTDRGQEGTARPPTPLGPLGCVPTIPATASAASPLTFPTLDDFIPPHLQRWPHHSQPARASGSFAPISQTPPSFSPPPPLVPPAPEDLRRVSEPDLTGAVSSTDSSPLLNEVSSSLIGTDSQAFPSVSKPSSAYPSTTIVNPTIVLLQHNREQQKRLSSLSDPVSERRVGEQDSAPTQEKPTSPGKAIEKRAKDDSRRVVKSTQDLSDVSMDEVGIPLRNTERSKDWYKTMFKQIHKLNRDTPEENPYFPTYKFPELPEIQQTSEEDNPYTPTYQFPASTPSPKSEDDDSDLYSPRYSFSEDTKSPLSVPRSKSEMSYIDGEKVVKRSATLPLPARSSSLKSSSERNDWEPPDKKVDTRKYRAEPKSIYEYQPGKSSVLTNEKMSRDISPEEIDLKNEPWYKFFSELEFGKPPPKKIWDYTPGDCSILPREDRKTNLDKDLSLCQTELEADLEKMETLNKAPSANVPQSSAISPTPEISSETPGYIYSSNFHAVKRESDGAPGDLTSLENERQIYKSVLEGGDIPLQGLSGLKRPSSSASTKDSESPRHFIPADYLESTEEFIRRRHDDKEKLLADQRRLKREQEEADIAARRHTGVIPTHHQFITNERFGDLLNIDDTAKRKSGSEMRPARAKFDFKAQTLKELPLQKGDIVYIYKQIDQNWYEGEHHGRVGIFPRTYIELLPPAEKAQPKKLTPVQVLEYGEAIAKFNFNGDTQVEMSFRKGERITLLRQVDENWYEGRIPGTSRQGIFPITYVDVIKRPLVKNPVDYMDLPFSSSPSRSATASPQFSSHSKLITPAPSSLPHSRRALSPEMHAVTSEWISLTVGVPGRRSLALTPPLPPLPEASIYNTDHLALSPRASPSLSLSLPHLSWSDRPTPRSVASPLALPSPHKTYSLAPTSQASLHMNGDGGVHTPSSGIHQDSFLQLPLGSSDSVISQLSDAFSSQSKRQPWREESGQYERKAERGAGERGPGGPKISKKSCLKPSDVVRCLSTEQRLSDLNTPEESRPGKPLGSAFPGSEAEQTERHRGGEQAGRKAARRGGSQQPQAQQRRVTPDRSQTSQDLFSYQALYSYIPQNDDELELRDGDIVDVMEKCDDGWFVGTSRRTKQFGTFPGNYVKPLYL