You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
DNTT
DNA nucleotidylexotransferase

Protein Summary
Description
Template-independent DNA polymerase which catalyzes the random addition of deoxynucleoside 5'-triphosphate to the 3'-end of a DNA initiator. One of the in vivo functions of this enzyme is the addition of nucleotides at the junction (N region) of rearranged Ig heavy chain and T-cell receptor gene segments during the maturation of B- and T-cells. This gene is a member of the DNA polymerase type-X family and encodes a template-independent DNA polymerase that catalyzes the addition of deoxynucleotides to the 3'-hydroxyl terminus of oligonucleotide primers. In vivo, the encoded protein is expressed in a restricted population of normal and malignant pre-B and pre-T lymphocytes during early differentiation, where it generates antigen receptor diversity by synthesizing non-germ line elements (N-regions) at the junctions of rearranged Ig heavy chain and T cell receptor gene segments. Alternatively spliced transcript variants encoding different isoforms of this gene have been described. [provide ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000371174
  • ENSP00000360216
  • ENSG00000107447
  • ENST00000630152
  • ENSP00000486733

Symbol
  • TDT
  • TDT
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
1
disease perturbation
0.68
molecular function
0.6
gene perturbation
0.55
disease
0.54


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1910.01   (req: < 5)
Gene RIFs: 10   (req: <= 3)
Antibodies: 544   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1910.01   (req: >= 5)
Gene RIFs: 10   (req: > 3)
Antibodies: 544   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 2
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Protein-Protein Interactions (197)
1 – 10 of 197
XRCC6
Tbio
Novelty: 0.0013086
Score: 0.977
Data Source: STRINGDB
LIG4
Tbio
Family: Enzyme
Novelty: 0.00177803
Score: 0.974
Data Source: STRINGDB
XRCC4
Tbio
Novelty: 0.00392596
Score: 0.96
Data Source: STRINGDB
XRCC5
Tbio
Novelty: 0.0019774
Score: 0.956
Data Source: STRINGDB
PRKDC
Tchem
Family: Kinase
Novelty: 0.00132843
Score: 0.942
Data Source: STRINGDB
DCLRE1C
Tbio
Novelty: 0.00510592
Score: 0.928
Data Source: STRINGDB
CASP3
Tchem
Family: Enzyme
Novelty: 0.00004276
Score: 0.902
Data Source: STRINGDB
PCNA
Tchem
Novelty: 0.00995674
Score: 0.897
Data Source: STRINGDB
ANXA5
Tbio
Novelty: 0.00011301
Score: 0.816
Data Source: STRINGDB
ALB
Tchem
Novelty: 0.0000092
Score: 0.801
Data Source: STRINGDB
Publication Statistics
PubMed Score  1910.01

PubMed score by year
PubTator Score  1837.19

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDPPRASHLSPRKKRPRQTGALMASSPQDIKFQDLVVFILEKKMGTTRRAFLMELARRKGFRVENELSDS
1-70
VTHIVAENNSGSDVLEWLQAQKVQVSSQPELLDVSWLIECIRAGKPVEMTGKHQLVVRRDYSDSTNPGPP
70-140
KTPPIAVQKISQYACQRRTTLNNCNQIFTDAFDILAENCEFRENEDSCVTFMRAASVLKSLPFTIISMKD
140-210
TEGIPCLGSKVKGIIEEIIEDGESSEVKAVLNDERYQSFKLFTSVFGVGLKTSEKWFRMGFRTLSKVRSD
210-280
KSLKFTRMQKAGFLYYEDLVSCVTRAEAEAVSVLVKEAVWAFLPDAFVTMTGGFRRGKKMGHDVDFLITS
280-350
PGSTEDEEQLLQKVMNLWEKKGLLLYYDLVESTFEKLRLPSRKVDALDHFQKCFLIFKLPRQRVDSDQSS
350-420
WQEGKTWKAIRVDLVLCPYERRAFALLGWTGSRQFERDLRRYATHERKMILDNHALYDKTKRIFLKAESE
420-490
EEIFAHLGLDYIEPWERNA
490-509
MDPPRASHLSPRKKRPRQTGALMASSPQDIKFQDLVVFILEKKMGTTRRAFLMELARRKGFRVENELSDSVTHIVAENNSGSDVLEWLQAQKVQVSSQPELLDVSWLIECIRAGKPVEMTGKHQLVVRRDYSDSTNPGPPKTPPIAVQKISQYACQRRTTLNNCNQIFTDAFDILAENCEFRENEDSCVTFMRAASVLKSLPFTIISMKDTEGIPCLGSKVKGIIEEIIEDGESSEVKAVLNDERYQSFKLFTSVFGVGLKTSEKWFRMGFRTLSKVRSDKSLKFTRMQKAGFLYYEDLVSCVTRAEAEAVSVLVKEAVWAFLPDAFVTMTGGFRRGKKMGHDVDFLITSPGSTEDEEQLLQKVMNLWEKKGLLLYYDLVESTFEKLRLPSRKVDALDHFQKCFLIFKLPRQRVDSDQSSWQEGKTWKAIRVDLVLCPYERRAFALLGWTGSRQFERDLRRYATHERKMILDNHALYDKTKRIFLKAESEEEIFAHLGLDYIEPWERNA