You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
KANK4
KN motif and ankyrin repeat domain-containing protein 4

Protein Summary
Description
May be involved in the control of cytoskeleton formation by regulating actin polymerization.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000354381
  • ENSP00000346352
  • ENSG00000132854
  • ENST00000371153
  • ENSP00000360195

Symbol
  • ANKRD38
  • ANKRD38
  • dJ1078M7.1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
PubMedID
0.65
tissue sample
0.61
microRNA
0.59
cell line
0.54
phenotype
0.49


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2.38   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 28   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2.38   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 28   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 1
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (4)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
HPA
Inferred from Direct Assay (IDA)
HPA
Protein-Protein Interactions (55)
1 – 10 of 55
TLN2
Tbio
Novelty: 0.0383066
p_int: 0.999999873
p_ni: 1.26e-7
p_wrong: 2e-9
Score: 0.361
Data Source: BioPlex,STRINGDB
TRAPPC9
Tbio
Novelty: 0.00597635
p_int: 0.999994448
p_ni: 0.000005552
Score: 0.788
Data Source: BioPlex,STRINGDB
C7orf43
Tdark
Novelty: 1.33333333
p_int: 0.999980385
p_ni: 0.000019614
Score: 0.816
Data Source: BioPlex,STRINGDB
OSCP1
Tbio
Novelty: 0.05185825
p_int: 0.999962042
p_ni: 0.000037937
p_wrong: 2.2e-8
Score: 0.237
Data Source: BioPlex,STRINGDB
TLN1
Tbio
Novelty: 0.00988479
p_int: 0.999942121
p_ni: 0.000057879
Score: 0.215
Data Source: BioPlex,STRINGDB
TRAPPC10
Tbio
Novelty: 0.0429625
p_int: 0.999897787
p_ni: 0.000102213
Score: 0.741
Data Source: BioPlex,STRINGDB
TRAPPC4
Tbio
Novelty: 0.12910497
p_int: 0.999176347
p_ni: 0.000823653
Score: 0.746
Data Source: BioPlex,STRINGDB
TRAPPC2
Tbio
Novelty: 0.01745001
p_int: 0.991377416
p_ni: 0.008622577
p_wrong: 6e-9
Score: 0.675
Data Source: BioPlex,STRINGDB
TRAPPC1
Tbio
Novelty: 0.1875
p_int: 0.989131433
p_ni: 0.010868567
Score: 0.813
Data Source: BioPlex,STRINGDB
TRAPPC3
Tbio
Novelty: 0.00933921
p_int: 0.970029287
p_ni: 0.029970713
Score: 0.811
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  2.38

PubMed score by year
PubTator Score  2.33

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MEKTDAKDQSSQGDEEKDPPKSHPYSVETPYGFHLDLDFLKYVDDIEKGNTIKRIPIHRRAKQAKFSTLP
1-70
RNFSLPDSGARPPAAPPLQNWSPVVPREASLGTQEQNQSPPLGNAPQASTSRSEVSYHRKALLAEATRQL
70-140
EAAEPEDAELTFGSGRPQLLRASSMPATLLHSRASEEPGLSLGPPAPPALPPLQGEGSVCDGTFEPAEGL
140-210
AGFHSSSPRASTRIPELVQEGAEPPEGVVKVPNHLPLPGPPFSFQNVLVVLEDKEDEHNAREAEVLFTPG
210-280
SPTPSPPPLPSPIPENELLLEEIELNISEIPPPPPVEVDMRSIGIRVTEESLGLARVDPGSISSLKQQVS
280-350
ALEGELSGRTEELAQVRTALQQQEEEIKAREQRIRELEFTVAQLEGQFHQENAKDTQGQTDVMVNTDPVH
350-420
GLLTRESCDKGIEVNLLGSMESESWGHRGEENGLLWGPDGHKQGNQSPAERVLLPQLSLPQGPEQVLTSS
420-490
VHSFLSTELRIEEAGTEQEGGPQGGTRGAGGFLWGSDRKTPPAGREETSSNLPGKEHPGRPPSSPTDATI
490-560
GQYVKKIQELLQEQWNCLEHGYPELASAIKQPASKLSSIQSQLLSSLNLLLSAYSAQAHPPKEPPASSSS
560-630
PPVEISPSTSLKSIMKKKDYGFRAGGNGTKKNLQFVGVNGGYETTSSEETSGEDSTPEDLSDSEAEKKCD
630-700
GPDHKHVKDAHLTCEAGQGIPEGTCHAAQESGPGEEVPHSKAERYKPSEEFLNACRALSQHLPETGTTTD
700-770
QLLRQSLNTISQEWFRVSSRKSSSPAVVASYLHEVQPHSPHFLKLLVNLADHNGNTALHYSVSHSNFSIV
770-840
KLLLETGVCNVDHQNKAGYTAVMITPLASAETNEDMAVVWKLLREGNVNIQATQGGQTALMLGVSHDRED
840-910
MVQALLSCQADVNLQDHDGSSALMVACHHGNVDLVRLLLAHPACDSSLTDKAGRTALSIALKSPTHMEIA
910-980
GLLRAHAEQGRSLGL
980-995
MEKTDAKDQSSQGDEEKDPPKSHPYSVETPYGFHLDLDFLKYVDDIEKGNTIKRIPIHRRAKQAKFSTLPRNFSLPDSGARPPAAPPLQNWSPVVPREASLGTQEQNQSPPLGNAPQASTSRSEVSYHRKALLAEATRQLEAAEPEDAELTFGSGRPQLLRASSMPATLLHSRASEEPGLSLGPPAPPALPPLQGEGSVCDGTFEPAEGLAGFHSSSPRASTRIPELVQEGAEPPEGVVKVPNHLPLPGPPFSFQNVLVVLEDKEDEHNAREAEVLFTPGSPTPSPPPLPSPIPENELLLEEIELNISEIPPPPPVEVDMRSIGIRVTEESLGLARVDPGSISSLKQQVSALEGELSGRTEELAQVRTALQQQEEEIKAREQRIRELEFTVAQLEGQFHQENAKDTQGQTDVMVNTDPVHGLLTRESCDKGIEVNLLGSMESESWGHRGEENGLLWGPDGHKQGNQSPAERVLLPQLSLPQGPEQVLTSSVHSFLSTELRIEEAGTEQEGGPQGGTRGAGGFLWGSDRKTPPAGREETSSNLPGKEHPGRPPSSPTDATIGQYVKKIQELLQEQWNCLEHGYPELASAIKQPASKLSSIQSQLLSSLNLLLSAYSAQAHPPKEPPASSSSPPVEISPSTSLKSIMKKKDYGFRAGGNGTKKNLQFVGVNGGYETTSSEETSGEDSTPEDLSDSEAEKKCDGPDHKHVKDAHLTCEAGQGIPEGTCHAAQESGPGEEVPHSKAERYKPSEEFLNACRALSQHLPETGTTTDQLLRQSLNTISQEWFRVSSRKSSSPAVVASYLHEVQPHSPHFLKLLVNLADHNGNTALHYSVSHSNFSIVKLLLETGVCNVDHQNKAGYTAVMITPLASAETNEDMAVVWKLLREGNVNIQATQGGQTALMLGVSHDREDMVQALLSCQADVNLQDHDGSSALMVACHHGNVDLVRLLLAHPACDSSLTDKAGRTALSIALKSPTHMEIAGLLRAHAEQGRSLGL