You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PHACTR3
Phosphatase and actin regulator 3

Protein Summary
Description
This gene encodes a member of the phosphatase and actin regulator protein family. The encoded protein is associated with the nuclear scaffold in proliferating cells, and binds to actin and the catalytic subunit of protein phosphatase-1, suggesting that it functions as a regulatory subunit of protein phosphatase-1. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000355648
  • ENSP00000347866
  • ENSG00000087495
  • ENST00000359926
  • ENSP00000353002
  • ENST00000361300
  • ENSP00000354555
  • ENST00000371015
  • ENSP00000360054
  • ENST00000395636
  • ENSP00000378998
  • ENST00000541461
  • ENSP00000442483

Symbol
  • C20orf101
  • SCAPIN1
  • H17739
  • SCAPIN1
  • PPP1R123
  • SCAPININ
  • C20orf101
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor
0.77
cell type or tissue
0.72
trait
0.61
molecular function
0.6
PubMedID
0.58


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 9.55   (req: < 5)
Gene RIFs: 9   (req: <= 3)
Antibodies: 107   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 9.55   (req: >= 5)
Gene RIFs: 9   (req: > 3)
Antibodies: 107   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (45)
1 – 10 of 45
PPP1CA
Tchem
Family: Enzyme
Novelty: 0.00685545
Score: 0.96
Data Source: STRINGDB
PPP1CB
Tbio
Family: Enzyme
Novelty: 0.01904575
Score: 0.942
Data Source: STRINGDB
BCAS4
Tbio
Novelty: 0.15459088
Score: 0.703
Data Source: STRINGDB
PFDN4
Tbio
Novelty: 0.02826158
Score: 0.691
Data Source: STRINGDB
RBM38
Tbio
Novelty: 0.04146599
Score: 0.677
Data Source: STRINGDB
CTCFL
Tbio
Family: TF
Novelty: 0.01373716
Score: 0.669
Data Source: STRINGDB
FAM19A4
Tbio
Novelty: 0.04762169
Score: 0.63
Data Source: STRINGDB
FAM209B
Tdark
Score: 0.56
Data Source: STRINGDB
CBLN4
Tbio
Novelty: 0.16541748
Score: 0.544
Data Source: STRINGDB
EIF4ENIF1
Tbio
Novelty: 0.02450838
Score: 0.54
Data Source: STRINGDB
Publication Statistics
PubMed Score  9.55

PubMed score by year
PubTator Score  7.12

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAASEDGSGCLVSRGRSQSDPSVLTDSSATSSADAGENPDEMDQTPPARPEYLVSGIRTPPVRRNSKLAT
1-70
LGRIFKPWKWRKKKNEKLKQTTSALEKKMAGRQGREELIKKGLLEMMEQDAESKTCNPDGGPRSVQSEPP
70-140
TPKSETLTSEDAQPGSPLATGTDQVSLDKPLSSAAHLDDAAKMPSASSGEEADAGSLLPTTNELSQALAG
140-210
ADSLDSPPRPLERSVGQLPSPPLLPTPPPKASSKTTKNVTGQATLFQASSMKSADPSLRGQLSTPTGSPH
210-280
LTTVHRPLPPSRVIEELHRALATKHRQDSFQGRESKGSPKKRLDVRLSRTSSVERGKEREEAWSFDGALE
280-350
NKRTAAKESEENKENLIINSELKDDLLLYQDEEALNDSIISGTLPRKCKKELLAVKLRNRPSKQELEDRN
350-420
IFPRRTDEERQEIRQQIEMKLSKRLSQRPAVEELERRNILKQRNDQTEQEERREIKQRLTRKLNQRPTVD
420-490
ELRDRKILIRFSDYVEVAKAQDYDRRADKPWTRLSAADKAAIRKELNEYKSNEMEVHASSKHLTRFHRP
490-559
MAASEDGSGCLVSRGRSQSDPSVLTDSSATSSADAGENPDEMDQTPPARPEYLVSGIRTPPVRRNSKLATLGRIFKPWKWRKKKNEKLKQTTSALEKKMAGRQGREELIKKGLLEMMEQDAESKTCNPDGGPRSVQSEPPTPKSETLTSEDAQPGSPLATGTDQVSLDKPLSSAAHLDDAAKMPSASSGEEADAGSLLPTTNELSQALAGADSLDSPPRPLERSVGQLPSPPLLPTPPPKASSKTTKNVTGQATLFQASSMKSADPSLRGQLSTPTGSPHLTTVHRPLPPSRVIEELHRALATKHRQDSFQGRESKGSPKKRLDVRLSRTSSVERGKEREEAWSFDGALENKRTAAKESEENKENLIINSELKDDLLLYQDEEALNDSIISGTLPRKCKKELLAVKLRNRPSKQELEDRNIFPRRTDEERQEIRQQIEMKLSKRLSQRPAVEELERRNILKQRNDQTEQEERREIKQRLTRKLNQRPTVDELRDRKILIRFSDYVEVAKAQDYDRRADKPWTRLSAADKAAIRKELNEYKSNEMEVHASSKHLTRFHRP