You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
GADD45A
Growth arrest and DNA damage-inducible protein GADD45 alpha

Protein Summary
Description
In T-cells, functions as a regulator of p38 MAPKs by inhibiting p88 phosphorylation and activity (By similarity). Might affect PCNA interaction with some CDK (cell division protein kinase) complexes; stimulates DNA excision repair in vitro and inhibits entry of cells into S phase. This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The DNA damage-induced transcription of this gene is mediated by both p53-dependent and -independent mechanisms. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.[provided by RefSeq, Dec 2010]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000370985
  • ENSP00000360024
  • ENSG00000116717
  • ENST00000370986
  • ENSP00000360025

Symbol
  • DDIT1
  • GADD45
  • DDIT1
  • GADD45
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
1
kinase perturbation
1
transcription factor binding site profile
0.98
PubMedID
0.96
small molecule perturbation
0.95


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 397.52   (req: < 5)
Gene RIFs: 123   (req: <= 3)
Antibodies: 374   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 397.52   (req: >= 5)
Gene RIFs: 123   (req: > 3)
Antibodies: 374   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 22
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (59)
FOXO-mediated transcription (R-HSA-9614085)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
FOXO-mediated transcription
Reactome
FOXO-mediated transcription of cell cycle genes
Reactome
Gene expression (Transcription)
Reactome
Generic Transcription Pathway
Reactome
RNA Polymerase II Transcription
Name
Explore in Pharos
Explore in Source
FOXO-mediated transcription
FOXO-mediated transcription of cell cycle genes
Gene expression (Transcription)
Generic Transcription Pathway
RNA Polymerase II Transcription
Gene Ontology Terms (26)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
CAFA
Inferred from Direct Assay (IDA)
CAFA
Inferred from Physical Interaction (IPI)
CAFA
Inferred from Physical Interaction (IPI)
CAFA
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (150)
1 – 10 of 150
MAP3K4
Tbio
Family: Kinase
Novelty: 0.02920916
p_int: 0.99999976
p_ni: 2.4e-7
Score: 0.971
Data Source: BioPlex,STRINGDB
LRIF1
Tdark
Novelty: 0.27114267
p_int: 0.980922668
p_ni: 0.019065399
p_wrong: 0.000011933
Data Source: BioPlex
CBX4
Tchem
Family: Epigenetic
Novelty: 0.0399549
p_int: 0.979290857
p_ni: 0.020688149
p_wrong: 0.000020995
Data Source: BioPlex
ZZZ3
Tdark
Family: TF
Novelty: 0.27962716
p_int: 0.961501318
p_ni: 0.038498669
p_wrong: 1.2e-8
Data Source: BioPlex
PEAK1
Tbio
Family: Kinase
Novelty: 0.00254215
p_int: 0.899109144
p_ni: 0.100890726
p_wrong: 1.3e-7
Data Source: BioPlex
DDX19B
Tbio
Family: Enzyme
Novelty: 0.05099873
p_int: 0.858923674
p_ni: 0.141076326
Data Source: BioPlex
REXO5
Tdark
Family: Enzyme
Novelty: 0.33333333
p_int: 0.83587087
p_ni: 0.164101484
p_wrong: 0.000027646
Data Source: BioPlex
PRR14L
Tdark
Novelty: 1.55555556
p_int: 0.798383178
p_ni: 0.201616822
Data Source: BioPlex
TP53
Tchem
Family: TF
Novelty: 0.00002203
Score: 0.989
Data Source: STRINGDB
CDK1
Tchem
Family: Kinase
Novelty: 0.00049984
Score: 0.981
Data Source: STRINGDB
Publication Statistics
PubMed Score  397.52

PubMed score by year
PubTator Score  393.28

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVA
1-70
LQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPAL
70-140
SQLICFCRESRYMDQWVPVINLPER
140-165
MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER