You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
DIRAS3
GTP-binding protein Di-Ras3

Protein Summary
Description
This gene encodes a member of the ras superfamily. This gene is imprinted gene with monoallelic expression of the paternal allele which is associated with growth suppression. The encoded protein acts as a tumor suppressor whose function is abrogated in many ovarian and breast cancers. This protein may also play a role autophagy in certain cancer cells by regulating the autophagosome initiation complex. [provided by RefSeq, Nov 2015]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000370981
  • ENSP00000360020
  • ENSG00000162595
  • ENST00000646789
  • ENSP00000495736

Symbol
  • ARHI
  • NOEY2
  • RHOI
  • ARHI
  • NOEY2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.91
PubMedID
0.7
cell type or tissue
0.64
protein domain
0.58
gene perturbation
0.57


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 86.07   (req: < 5)
Gene RIFs: 51   (req: <= 3)
Antibodies: 157   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 86.07   (req: >= 5)
Gene RIFs: 51   (req: > 3)
Antibodies: 157   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (6)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (51)
1 – 10 of 51
SLC30A1
Tbio
Family: Transporter
Novelty: 0.00733144
p_int: 0.997734111
p_ni: 0.002265889
Score: 0.209
Data Source: BioPlex,STRINGDB
MTIF2
Tbio
Novelty: 0.10273973
p_int: 0.996370732
p_ni: 0.003629268
Score: 0.173
Data Source: BioPlex,STRINGDB
FEZ2
Tbio
Novelty: 0.38227628
p_int: 0.986935851
p_ni: 0.012919706
p_wrong: 0.000144443
Score: 0.356
Data Source: BioPlex,STRINGDB
RNF19B
Tbio
Family: Enzyme
Novelty: 0.17995417
p_int: 0.917117447
p_ni: 0.082137021
p_wrong: 0.000745532
Score: 0.226
Data Source: BioPlex,STRINGDB
DCAF10
Tdark
Novelty: 10
p_int: 0.870585076
p_ni: 0.129414924
Score: 0.237
Data Source: BioPlex,STRINGDB
STAT3
Tchem
Family: TF
Novelty: 0.00013496
Score: 0.735
Data Source: STRINGDB
IARS
Tchem
Family: Enzyme
Novelty: 0.0033571
Score: 0.666
Data Source: STRINGDB
KDM4A
Tchem
Family: Epigenetic
Novelty: 0.0007891
Score: 0.658
Data Source: STRINGDB
PLAGL1
Tbio
Family: TF
Novelty: 0.00840594
Score: 0.654
Data Source: STRINGDB
NAP1L5
Tbio
Novelty: 0.14224726
Score: 0.647
Data Source: STRINGDB
Publication Statistics
PubMed Score  86.07

PubMed score by year
PubTator Score  112.04

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGNASFGSKEQKLLKRLRLLPALLILRAFKPHRKIRDYRVVVVGTAGVGKSTLLHKWASGNFRHEYLPTI
1-70
ENTYCQLLGCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGN
70-140
NLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPE
140-210
KKSQMPNTTEKLLDKCIIM
210-229
MGNASFGSKEQKLLKRLRLLPALLILRAFKPHRKIRDYRVVVVGTAGVGKSTLLHKWASGNFRHEYLPTIENTYCQLLGCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGNNLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPEKKSQMPNTTEKLLDKCIIM