You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
GFI1
Zinc finger protein Gfi-1

Protein Summary
Description
Transcription repressor essential for hematopoiesis. Functions in a cell-context and development-specific manner. Binds to 5'-TAAATCAC[AT]GCA-3' in the promoter region of a large number of genes. Component of several complexes, including the EHMT2-GFI1-HDAC1, AJUBA-GFI1-HDAC1 and RCOR-GFI-KDM1A-HDAC complexes, that suppress, via histone deacetylase (HDAC) recruitment, a number of genes implicated in multilineage blood cell development. Regulates neutrophil differentiation, promotes proliferation of lymphoid cells, and is required for granulocyte development. Mediates, together with U2AF1L4, the alternative splicing of CD45 and controls T-cell receptor signaling. Regulates the endotoxin-mediated Toll-like receptor (TLR) inflammatory response by antagonizing RELA. Cooperates with CBFA2T2 to regulate ITGB1-dependent neurite growth. Controls cell-cycle progression by repressing CDKNIA/p21 transcription in response to TGFB1 via recruitment of GFI1 by ZBTB17 to the CDKNIA/p21 and CDKNIB prom ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000294702
  • ENSP00000294702
  • ENSG00000162676
  • ENST00000370332
  • ENSP00000359357
  • ENST00000427103
  • ENSP00000399719

Symbol
  • ZNF163
  • SCN2
  • GFI-1
  • GFI1A
  • ZNF163
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.97
gene perturbation
0.91
molecular function
0.73
transcription factor
0.73
phenotype
0.65


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 189.81   (req: < 5)
Gene RIFs: 46   (req: <= 3)
Antibodies: 258   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 189.81   (req: >= 5)
Gene RIFs: 46   (req: > 3)
Antibodies: 258   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 19
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (26)
Developmental Biology (R-HSA-1266738)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 2 of 2
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Developmental Biology
Reactome
Transcriptional regulation of granulopoiesis
Name
Explore in Pharos
Explore in Source
Developmental Biology
Transcriptional regulation of granulopoiesis
Gene Ontology Terms (24)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Sequence Alignment (ISA)
NTNU_SB
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (132)
1 – 10 of 132
MYC
Tbio
Family: TF
Novelty: 0.000073
Score: 0.944
Data Source: STRINGDB
ZBTB17
Tbio
Family: TF
Novelty: 0.02645778
Score: 0.94
Data Source: STRINGDB
SPI1
Tbio
Family: TF
Novelty: 0.0008303
Score: 0.92
Data Source: STRINGDB
DNMT3A
Tclin
Family: Epigenetic
Novelty: 0.0010559
Score: 0.916
Data Source: STRINGDB
MAX
Tbio
Family: TF
Novelty: 0.00681918
Score: 0.903
Data Source: STRINGDB
POU4F3
Tbio
Family: TF
Novelty: 0.01562004
Score: 0.801
Data Source: STRINGDB
TP53
Tchem
Family: TF
Novelty: 0.00002203
Score: 0.785
Data Source: STRINGDB
ID2
Tbio
Family: TF
Novelty: 0.00329378
Score: 0.761
Data Source: STRINGDB
ELANE
Tclin
Family: Enzyme
Novelty: 0.00030106
Score: 0.748
Data Source: STRINGDB
CEBPE
Tbio
Family: TF
Novelty: 0.01347316
Score: 0.715
Data Source: STRINGDB
Publication Statistics
PubMed Score  189.81

PubMed score by year
PubTator Score  167.93

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPRSFLVKSKKAHSYHQPRSPGPDYSLRLENVPAPSRADSTSNAGGAKAEPRDRLSPESQLTEAPDRASA
1-70
SPDSCEGSVCERSSEFEDFWRPPSPSASPASEKSMCPSLDEAQPFPLPFKPYSWSGLAGSDLRHLVQSYR
70-140
PCGALERGAGLGLFCEPAPEPGHPAALYGPKRAAGGAGAGAPGSCSAGAGATAGPGLGLYGDFGSAAAGL
140-210
YERPTAAAGLLYPERGHGLHADKGAGVKVESELLCTRLLLGGGSYKCIKCSKVFSTPHGLEVHVRRSHSG
210-280
TRPFACEMCGKTFGHAVSLEQHKAVHSQERSFDCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFH
280-350
QKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQHG
350-420
LK
420-422
MPRSFLVKSKKAHSYHQPRSPGPDYSLRLENVPAPSRADSTSNAGGAKAEPRDRLSPESQLTEAPDRASASPDSCEGSVCERSSEFEDFWRPPSPSASPASEKSMCPSLDEAQPFPLPFKPYSWSGLAGSDLRHLVQSYRPCGALERGAGLGLFCEPAPEPGHPAALYGPKRAAGGAGAGAPGSCSAGAGATAGPGLGLYGDFGSAAAGLYERPTAAAGLLYPERGHGLHADKGAGVKVESELLCTRLLLGGGSYKCIKCSKVFSTPHGLEVHVRRSHSGTRPFACEMCGKTFGHAVSLEQHKAVHSQERSFDCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQHGLK