You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
OPN1LW
Long-wave-sensitive opsin 1

Protein Summary
Description
Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal. This gene encodes for a light absorbing visual pigment of the opsin gene family. The encoded protein is called red cone photopigment or long-wavelength sensitive opsin. Opsins are G-protein coupled receptors with seven transmembrane domains, an N-terminal extracellular domain, and a C-terminal cytoplasmic domain. This gene and the medium-wavelength opsin gene are tandemly arrayed on the X chromosome and frequent unequal recombination and gene conversion may occur between these sequences. X chromosomes may have fusions of the medium- and long-wavelength opsin genes or may have more than one copy of these genes. Defects in this gene are the cause of partial, protanopic colorblindness. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000369951
  • ENSP00000358967
  • ENSG00000102076

Symbol
  • RCP
  • CBP
  • RCP
  • ROP
  • CBBM
  • COD5
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
tissue sample
0.73
gene perturbation
0.62
cellular component
0.57
pathway
0.51
virus perturbation
0.45


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 228.09   (req: < 5)
Gene RIFs: 26   (req: <= 3)
Antibodies: 42   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 228.09   (req: >= 5)
Gene RIFs: 26   (req: > 3)
Antibodies: 42   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 10
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (17)
Class A/1 (Rhodopsin-like receptors) (R-HSA-373076)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 13
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Class A/1 (Rhodopsin-like receptors)
Reactome
Disease
Reactome
Diseases associated with visual transduction
Reactome
Diseases of signal transduction
Reactome
G alpha (i) signalling events
Name
Explore in Pharos
Explore in Source
Class A/1 (Rhodopsin-like receptors)
Disease
Diseases associated with visual transduction
Diseases of signal transduction
G alpha (i) signalling events
Protein-Protein Interactions (55)
1 – 10 of 55
GNAT2
Tbio
Novelty: 0.02455598
Score: 0.951
Data Source: Reactome,STRINGDB
GNB3
Tbio
Novelty: 0.0043523
Score: 0.938
Data Source: STRINGDB
GNGT2
Tbio
Novelty: 0.05824157
Score: 0.932
Data Source: STRINGDB
GNGT1
Tbio
Novelty: 0.03653174
Score: 0.926
Data Source: STRINGDB
GNAT1
Tbio
Novelty: 0.03296558
Score: 0.921
Data Source: Reactome,STRINGDB
GNB1
Tbio
Novelty: 0.04716243
Score: 0.917
Data Source: Reactome,STRINGDB
GNB2
Tbio
Novelty: 0.20536996
Score: 0.917
Data Source: STRINGDB
GNB4
Tbio
Novelty: 0.1530232
Score: 0.917
Data Source: STRINGDB
GNB5
Tbio
Novelty: 0.01077999
Score: 0.916
Data Source: STRINGDB
OPN5
Tbio
Family: GPCR
Novelty: 0.05484116
Score: 0.916
Data Source: STRINGDB
Publication Statistics
PubMed Score  228.09

PubMed score by year
PubTator Score  88.45

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MAQQWSLQRLAGRHPQDSYEDSTQSSIFTYTNSNSTRGPFEGPNYHIAPRWVYHLTSVWMIFVVTASVFT
1-70
NGLVLAATMKFKKLRHPLNWILVNLAVADLAETVIASTISIVNQVSGYFVLGHPMCVLEGYTVSLCGITG
70-140
LWSLAIISWERWLVVCKPFGNVRFDAKLAIVGIAFSWIWSAVWTAPPIFGWSRYWPHGLKTSCGPDVFSG
140-210
SSYPGVQSYMIVLMVTCCIIPLAIIMLCYLQVWLAIRAVAKQQKESESTQKAEKEVTRMVVVMIFAYCVC
210-280
WGPYTFFACFAAANPGYAFHPLMAALPAYFAKSATIYNPVIYVFMNRQFRNCILQLFGKKVDDGSELSSA
280-350
SKTEVSSVSSVSPA
350-364
MAQQWSLQRLAGRHPQDSYEDSTQSSIFTYTNSNSTRGPFEGPNYHIAPRWVYHLTSVWMIFVVTASVFTNGLVLAATMKFKKLRHPLNWILVNLAVADLAETVIASTISIVNQVSGYFVLGHPMCVLEGYTVSLCGITGLWSLAIISWERWLVVCKPFGNVRFDAKLAIVGIAFSWIWSAVWTAPPIFGWSRYWPHGLKTSCGPDVFSGSSYPGVQSYMIVLMVTCCIIPLAIIMLCYLQVWLAIRAVAKQQKESESTQKAEKEVTRMVVVMIFAYCVCWGPYTFFACFAAANPGYAFHPLMAALPAYFAKSATIYNPVIYVFMNRQFRNCILQLFGKKVDDGSELSSASKTEVSSVSSVSPA