You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
HTR1B
5-hydroxytryptamine receptor 1B

Protein Summary
Description
G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for ergot alkaloid derivatives, various anxiolytic and antidepressant drugs and other psychoactive substances, such as lysergic acid diethylamide (LSD). Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling inhibits adenylate cyclase activity. Arrestin family members inhibit signaling via G proteins and mediate activation of alternative signaling pathways. Regulates the release of 5-hydroxytryptamine, dopamine and acetylcholine in the brain, and thereby affects neural activity, nociceptive processing, pain perception, mood and behavior. Besides, plays a role in vasoconstriction of cerebral arteries. The protein encoded by this intronless gene is a G-protein coupled receptor for serotonin (5-hydroxytryptamine). Ligand binding activates secon ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000369947
  • ENSP00000358963
  • ENSG00000135312

Symbol
  • HTR1DB
  • S12
  • 5-HT1B
  • HTR1D2
  • HTR1DB
  • 5-HT-1B
  • 5-HT1DB
  • 5-HT-1D-beta
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
ligand (chemical)
1
drug
0.98
biological process
0.91
disease
0.76
gene perturbation
0.74


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1096.92   (req: < 5)
Gene RIFs: 100   (req: <= 3)
Antibodies: 277   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1096.92   (req: >= 5)
Gene RIFs: 100   (req: > 3)
Antibodies: 277   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 30
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 524
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 28
Protein Data Bank (5)
1 – 5 of 5
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (20)
Amine ligand-binding receptors (R-HSA-375280)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Amine ligand-binding receptors
Reactome
Class A/1 (Rhodopsin-like receptors)
Reactome
G alpha (i) signalling events
Reactome
GPCR downstream signalling
Reactome
GPCR ligand binding
Name
Explore in Pharos
Explore in Source
Amine ligand-binding receptors
Class A/1 (Rhodopsin-like receptors)
G alpha (i) signalling events
GPCR downstream signalling
GPCR ligand binding
Gene Ontology Terms (37)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (280)
1 – 10 of 280
CD209
Tbio
Novelty: 0.001619
p_int: 0.999614359
p_wrong: 0.00038564
Score: 0.689
Data Source: BioPlex,STRINGDB
GNG2
Tbio
Novelty: 0.08273543
Score: 0.989
Data Source: STRINGDB
GNB1
Tbio
Novelty: 0.04716243
Score: 0.988
Data Source: STRINGDB
NPY
Tbio
Novelty: 0.00014761
Score: 0.948
Data Source: STRINGDB
HTR1A
Tclin
Family: GPCR
Novelty: 0.00019966
Score: 0.944
Data Source: STRINGDB
POMC
Tbio
Novelty: 0.00002654
Score: 0.943
Data Source: STRINGDB
P2RY14
Tchem
Family: GPCR
Novelty: 0.02096508
Score: 0.938
Data Source: STRINGDB
GNB3
Tbio
Novelty: 0.0043523
Score: 0.937
Data Source: STRINGDB
HTR1D
Tclin
Family: GPCR
Novelty: 0.00266446
Score: 0.933
Data Source: STRINGDB
GRM2
Tchem
Family: GPCR
Novelty: 0.00160856
Score: 0.931
Data Source: STRINGDB
Publication Statistics
PubMed Score  1096.92

PubMed score by year
PubTator Score  644.68

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKVLLVMLLALITLATTLSNAFV
1-70
IATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSDITCCTASILHL
70-140
CVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFFWRQAKAEEEVSECVVNTDHILYTV
140-210
YSTVGAFYFPTLLLIALYGRIYVEARSRILKQTPNRTGKRLTRAQLITDSPGSTSSVTSINSRVPDVPSE
210-280
SGSPVYVNQVKVRVSDALLEKKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAI
280-350
FDFFTWLGYLNSLINPIIYTMSNEDFKQAFHKLIRFKCTS
350-390
MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKVLLVMLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFFWRQAKAEEEVSECVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRILKQTPNRTGKRLTRAQLITDSPGSTSSVTSINSRVPDVPSESGSPVYVNQVKVRVSDALLEKKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYLNSLINPIIYTMSNEDFKQAFHKLIRFKCTS