You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
WNT2B
Protein Wnt-2b

Protein Summary
Description
Ligand for members of the frizzled family of seven transmembrane receptors. Functions in the canonical Wnt/beta-catenin signaling pathway. Plays a redundant role in embryonic lung development. This gene encodes a member of the wingless-type MMTV integration site (WNT) family of highly conserved, secreted signaling factors. WNT family members function in a variety of developmental processes including regulation of cell growth and differentiation and are characterized by a WNT-core domain. This gene may play a role in human development as well as carcinogenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000369684
  • ENSP00000358698
  • ENSG00000134245
  • ENST00000369686
  • ENSP00000358700

Symbol
  • WNT13
  • WNT13
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor binding site profile
0.83
transcription factor
0.76
biological process
0.68
pathway
0.68
PubMedID
0.66


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 83.56   (req: < 5)
Gene RIFs: 21   (req: <= 3)
Antibodies: 226   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 83.56   (req: >= 5)
Gene RIFs: 21   (req: > 3)
Antibodies: 226   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 16
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (58)
Class B/2 (Secretin family receptors) (R-HSA-373080)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Class B/2 (Secretin family receptors)
Reactome
GPCR ligand binding
Reactome
Signal Transduction
Reactome
Signaling by GPCR
Reactome
Signaling by WNT
Name
Explore in Pharos
Explore in Source
Class B/2 (Secretin family receptors)
GPCR ligand binding
Signal Transduction
Signaling by GPCR
Signaling by WNT
Gene Ontology Terms (19)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (136)
1 – 10 of 136
FZD1
Tbio
Family: GPCR
Novelty: 0.00772255
Score: 0.979
Data Source: STRINGDB
FZD4
Tchem
Family: GPCR
Novelty: 0.00765487
Score: 0.977
Data Source: STRINGDB
FZD2
Tbio
Family: GPCR
Novelty: 0.01294873
Score: 0.977
Data Source: STRINGDB
FZD8
Tbio
Family: GPCR
Novelty: 0.02080497
Score: 0.974
Data Source: STRINGDB
FZD7
Tbio
Family: GPCR
Novelty: 0.01307342
Score: 0.973
Data Source: STRINGDB
FZD6
Tbio
Family: GPCR
Novelty: 0.02056934
Score: 0.972
Data Source: STRINGDB
FZD9
Tbio
Family: GPCR
Novelty: 0.01543758
Score: 0.972
Data Source: STRINGDB
FZD5
Tbio
Family: GPCR
Novelty: 0.02565022
Score: 0.971
Data Source: STRINGDB
FZD10
Tbio
Family: GPCR
Novelty: 0.03473251
Score: 0.967
Data Source: STRINGDB
WLS
Tbio
Novelty: 0.0028553
Score: 0.966
Data Source: STRINGDB
Publication Statistics
PubMed Score  83.56

PubMed score by year
PubTator Score  47.17

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MLRPGGAEEAAQLPLRRASAPVPVPSPAAPDGSRASARLGLACLLLLLLLTLPARVDTSWWYIGALGARV
1-70
ICDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNCTTLDRDHTVFGRVMLRSSREAA
70-140
FVYAISSAGVVHAITRACSQGELSVCSCDPYTRGRHHDQRGDFDWGGCSDNIHYGVRFAKAFVDAKEKRL
140-210
KDARALMNLHNNRCGRTAVRRFLKLECKCHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVMATQD
210-280
GANFTAARQGYRRATRTDLVYFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVT
280-350
RVTQCECKFHWCCAVRCKECRNTVDVHTCKAPKKAEWLDQT
350-391
MLRPGGAEEAAQLPLRRASAPVPVPSPAAPDGSRASARLGLACLLLLLLLTLPARVDTSWWYIGALGARVICDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNCTTLDRDHTVFGRVMLRSSREAAFVYAISSAGVVHAITRACSQGELSVCSCDPYTRGRHHDQRGDFDWGGCSDNIHYGVRFAKAFVDAKEKRLKDARALMNLHNNRCGRTAVRRFLKLECKCHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRTDLVYFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQCECKFHWCCAVRCKECRNTVDVHTCKAPKKAEWLDQT