You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SYCP1
Synaptonemal complex protein 1

Protein Summary
Description
Major component of the transverse filaments of synaptonemal complexes, formed between homologous chromosomes during meiotic prophase. Required for normal assembly of the central element of the synaptonemal complexes. Required for normal centromere pairing during meiosis. Required for normal meiotic chromosome synapsis during oocyte and spermatocyte development and for normal male and female fertility.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000369518
  • ENSP00000358531
  • ENSG00000198765
  • ENST00000369522
  • ENSP00000358535
  • ENST00000618516
  • ENSP00000480997

Symbol
  • SCP1
  • CT8
  • SCP1
  • SCP-1
  • HOM-TES-14
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.78
cellular component
0.62
disease perturbation
0.62
trait
0.61
cell line
0.59


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 45.25   (req: < 5)
Gene RIFs: 6   (req: <= 3)
Antibodies: 204   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 45.25   (req: >= 5)
Gene RIFs: 6   (req: > 3)
Antibodies: 204   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 11
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (5)
1 – 5 of 5
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (4)
Cell Cycle (R-HSA-1640170)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cell Cycle
Reactome
Meiosis
Reactome
Meiotic synapsis
Reactome
Reproduction
Name
Explore in Pharos
Explore in Source
Cell Cycle
Meiosis
Meiotic synapsis
Reproduction
Gene Ontology Terms (16)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
ProtInc
Protein-Protein Interactions (114)
1 – 10 of 114
CREB1
Tbio
Family: TF
Novelty: 0.00022127
p_int: 0.752549888
p_ni: 0.247409277
p_wrong: 0.000040835
Score: 0.266
Data Source: BioPlex,STRINGDB
SYCP2
Tbio
Novelty: 0.08983562
Score: 0.993
Data Source: STRINGDB
SYCE2
Tdark
Novelty: 0.24565206
Score: 0.993
Data Source: STRINGDB
SYCP3
Tbio
Novelty: 0.00585649
Score: 0.992
Data Source: STRINGDB
SYCE1
Tbio
Novelty: 0.07934297
Score: 0.992
Data Source: STRINGDB
SYCE3
Tdark
Novelty: 0.14332025
Score: 0.986
Data Source: STRINGDB
TEX12
Tdark
Novelty: 0.23020005
Score: 0.981
Data Source: STRINGDB
REC8
Tbio
Novelty: 0.0111996
Score: 0.976
Data Source: STRINGDB
STAG3
Tbio
Novelty: 0.0450708
Score: 0.975
Data Source: STRINGDB
SMC1B
Tbio
Novelty: 0.04785672
Score: 0.965
Data Source: STRINGDB
Publication Statistics
PubMed Score  45.25

PubMed score by year
PubTator Score  58.3

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MEKQKPFALFVPPRSSSSQVSAVKPQTLGGDSTFFKSFNKCTEDDFEFPFAKTNLSKNGENIDSDPALQK
1-70
VNFLPVLEQVGNSDCHYQEGLKDSDLENSEGLSRVYSKLYKEAEKIKKWKVSTEAELRQKESKLQENRKI
70-140
IEAQRKAIQELQFGNEKVSLKLEEGIQENKDLIKENNATRHLCNLLKETCARSAEKTKKYEYEREETRQV
140-210
YMDLNNNIEKMITAFEELRVQAENSRLEMHFKLKEDYEKIQHLEQEYKKEINDKEKQVSLLLIQITEKEN
210-280
KMKDLTFLLEESRDKVNQLEEKTKLQSENLKQSIEKQHHLTKELEDIKVSLQRSVSTQKALEEDLQIATK
280-350
TICQLTEEKETQMEESNKARAAHSFVVTEFETTVCSLEELLRTEQQRLEKNEDQLKILTMELQKKSSELE
350-420
EMTKLTNNKEVELEELKKVLGEKETLLYENKQFEKIAEELKGTEQELIGLLQAREKEVHDLEIQLTAITT
420-490
SEQYYSKEVKDLKTELENEKLKNTELTSHCNKLSLENKELTQETSDMTLELKNQQEDINNNKKQEERMLK
490-560
QIENLQETETQLRNELEYVREELKQKRDEVKCKLDKSEENCNNLRKQVENKNKYIEELQQENKALKKKGT
560-630
AESKQLNVYEIKVNKLELELESAKQKFGEITDTYQKEIEDKKISEENLLEEVEKAKVIADEAVKLQKEID
630-700
KRCQHKIAEMVALMEKHKHQYDKIIEERDSELGLYKSKEQEQSSLRASLEIELSNLKAELLSVKKQLEIE
700-770
REEKEKLKREAKENTATLKEKKDKKTQTFLLETPEIYWKLDSKAVPSQTVSRNFTSVDHGISKDKRDYLW
770-840
TSAKNTLSTPLPKAYTVKTPTKPKLQQRENLNIPIEESKKKRKMAFEFDINSDSSETTDLLSMVSEEETL
840-910
KTLYRNNNPPASHLCVKTPKKAPSSLTTPGSTLKFGAIRKMREDRWAVIAKMDRKKKLKEAEKLFV
910-976
MEKQKPFALFVPPRSSSSQVSAVKPQTLGGDSTFFKSFNKCTEDDFEFPFAKTNLSKNGENIDSDPALQKVNFLPVLEQVGNSDCHYQEGLKDSDLENSEGLSRVYSKLYKEAEKIKKWKVSTEAELRQKESKLQENRKIIEAQRKAIQELQFGNEKVSLKLEEGIQENKDLIKENNATRHLCNLLKETCARSAEKTKKYEYEREETRQVYMDLNNNIEKMITAFEELRVQAENSRLEMHFKLKEDYEKIQHLEQEYKKEINDKEKQVSLLLIQITEKENKMKDLTFLLEESRDKVNQLEEKTKLQSENLKQSIEKQHHLTKELEDIKVSLQRSVSTQKALEEDLQIATKTICQLTEEKETQMEESNKARAAHSFVVTEFETTVCSLEELLRTEQQRLEKNEDQLKILTMELQKKSSELEEMTKLTNNKEVELEELKKVLGEKETLLYENKQFEKIAEELKGTEQELIGLLQAREKEVHDLEIQLTAITTSEQYYSKEVKDLKTELENEKLKNTELTSHCNKLSLENKELTQETSDMTLELKNQQEDINNNKKQEERMLKQIENLQETETQLRNELEYVREELKQKRDEVKCKLDKSEENCNNLRKQVENKNKYIEELQQENKALKKKGTAESKQLNVYEIKVNKLELELESAKQKFGEITDTYQKEIEDKKISEENLLEEVEKAKVIADEAVKLQKEIDKRCQHKIAEMVALMEKHKHQYDKIIEERDSELGLYKSKEQEQSSLRASLEIELSNLKAELLSVKKQLEIEREEKEKLKREAKENTATLKEKKDKKTQTFLLETPEIYWKLDSKAVPSQTVSRNFTSVDHGISKDKRDYLWTSAKNTLSTPLPKAYTVKTPTKPKLQQRENLNIPIEESKKKRKMAFEFDINSDSSETTDLLSMVSEEETLKTLYRNNNPPASHLCVKTPKKAPSSLTTPGSTLKFGAIRKMREDRWAVIAKMDRKKKLKEAEKLFV